PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G141800.1
Common NamePOPTR_0015s13340g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 754aa    MW: 83020.4 Da    PI: 5.9077
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G141800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox651e-2058113156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+k  ++t++q++eLe++F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
  Potri.015G141800.1  58 RKKYNRHTANQIQELESFFKECPHPDEKQRSELSRRLGLESKQIKFWFQNRRTQMK 113
                         79999************************************************999 PP

2START181.25.9e-572634852205
                         HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                         la++a++el+k a++e+p W ks     e +n +e++++f++  +     + +ea r+sgvv +++ +lve+l+d++  W e+++    +a
  Potri.015G141800.1 263 LALAAMDELIKIAQVESPIWIKSLdggkEVLNHEEYMRTFPPCIGmkpsnFVIEATRESGVVLANSLDLVETLMDVN-GWVEMFPsliaRA 352
                         6899**********************9999************999999999**************************.************* PP

                         EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
               START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                         +t++ +ssg      galq + ae+q++sp vp R + f+R ++ql +g+w+++dvSvd +q++ + +  v +++lpSg++i+++ ng +k
  Potri.015G141800.1 353 ATIDIVSSGmggtksGALQMIHAEFQVISPFVPvRQVKFLRLCKQLAEGVWAVADVSVDGNQENLNAQTPVTCRRLPSGCIIQDMNNGCCK 443
                         ****************************************************************999999999****************** PP

                         EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
               START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                         vtwveh +++++ +h l+r++++sg+ +ga++w a+lqr+ e
  Potri.015G141800.1 444 VTWVEHSEYDESAVHRLYRHILNSGMGFGAQRWIAALQRHYE 485
                         ***************************************977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.09E-1944115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-2145115IPR009057Homeodomain-like
PROSITE profilePS5007118.25355115IPR001356Homeobox domain
SMARTSM003891.5E-1857119IPR001356Homeobox domain
PfamPF000462.9E-1858113IPR001356Homeobox domain
CDDcd000869.73E-1958115No hitNo description
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
PROSITE profilePS5084839.624253489IPR002913START domain
SuperFamilySSF559615.92E-32254485No hitNo description
CDDcd088752.40E-114257485No hitNo description
SMARTSM002341.6E-40262486IPR002913START domain
PfamPF018522.6E-49263485IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-4326483IPR023393START-like domain
SuperFamilySSF559611.59E-15514749No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MPKNKMDSHG DMGLLGEHFD PSLVGRMRED GYESRSGSDN IEGASGEDQD AGDYQRPRKK  60
YNRHTANQIQ ELESFFKECP HPDEKQRSEL SRRLGLESKQ IKFWFQNRRT QMKTQLERHE  120
NAILRQENDK LRAENELLKQ NMSDPICNNC GGPVVPVPVS YEQQQLRIEN ARLKDELGRV  180
CALANKFLGR PLTSSASPVP PFGSNTKFDL AVGRNGYGNL GHTDNTLPMG LDNNGGVMMP  240
LMKPIGNAVG NEVPFDRSMF VDLALAAMDE LIKIAQVESP IWIKSLDGGK EVLNHEEYMR  300
TFPPCIGMKP SNFVIEATRE SGVVLANSLD LVETLMDVNG WVEMFPSLIA RAATIDIVSS  360
GMGGTKSGAL QMIHAEFQVI SPFVPVRQVK FLRLCKQLAE GVWAVADVSV DGNQENLNAQ  420
TPVTCRRLPS GCIIQDMNNG CCKVTWVEHS EYDESAVHRL YRHILNSGMG FGAQRWIAAL  480
QRHYECMAML LSPTILGEDQ TVINLGGKKS MLKLARRMVD SFCSGVCAST LHNWGNLVVE  540
SVSEDVRILT RKIINEPGEP DGIVLSVSTS VWLPVSQQRL FDFLRDEQSR SQWDILSNGG  600
ILQEMVQIPK GQGHWNTVSV LRSTAVDANA SDNMLILQET WNDVSGSLVV YAPVDVQSVS  660
VVMNGGDSTY VALLPSGFVI LPGNSFSNGE PNNCNGNPAK RDCDGNSGGG SFLTVGFQIL  720
ASNLPSAKLT VESVKTVHNL ISCTMQRIKT AFN*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G141800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024442055.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2K1XMT60.0A0A2K1XMT6_POPTR; Uncharacterized protein
STRINGPOPTR_0015s13340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]