PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G139300.1
Common NamePOPTR_0015s13560g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 726aa    MW: 83760.7 Da    PI: 6.4003
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G139300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR179.37e-2561146288
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                          Yn+YAk vGFsvrk+  ++sk +g +++r+f+Cskeg+r+++k++  + +++++etrtgC a++ v+++ dgk++vt+ e eHnH+
  Potri.015G139300.1  61 IYNKYAKVVGFSVRKDWLNRSKVHGLVVSRKFTCSKEGYRRKDKRD-LNVKKRQKETRTGCLAHMIVTRQPDGKYRVTHSEAEHNHD 146
                         7******************************************999.88889999*******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.7E-2261146IPR004330FAR1 DNA binding domain
PfamPF105513.9E-28270364IPR018289MULE transposase domain
PROSITE profilePS509669.829550586IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MEIGLPTSDR MDLNIDQDCC SSNSALVNAS QLSASSKDDA YRGGLLKIGT EFESDEHAYR  60
IYNKYAKVVG FSVRKDWLNR SKVHGLVVSR KFTCSKEGYR RKDKRDLNVK KRQKETRTGC  120
LAHMIVTRQP DGKYRVTHSE AEHNHDSIEP NNADTQLLQR ELFVDQAAKA DLSRNSGTES  180
SSNYGLMNRR IEVCQSLDYL AMDFENSLRS ERIRDMKEGE AGRLLRYFHR QHIENPSFIH  240
GIQVDIDDKV CNIFWADDKM VVDYDHFGDV VCLDTIYRTN KDLQPFVQFM GVNHHNQAII  300
FAAALLFDDT VESLKWLFNT FLEAMSGKKP KVILTDQDAA IAEAVNSILP ETSHRICVWQ  360
MYQNVLKHLS HLVKDIESFS CDFRSCIYES NYEEAFVHAW EGLLDKYGLQ QNEWLRWMFR  420
EREKWSIVYG SNTFFLDMKG THVVEDLSNN LRSYLNSDQD ALQIFKIFER VVNEQRVKEI  480
HANDEMTRCM PRLLGNVVLL KHASASYTPK AFEIFQKEYE KCLNVEVSQC NENGFLLEYK  540
VNTFGRTQEY TVTINSTDDT VVCNCMKFEN VGFLCGHTLK VLDNRKIKMV PSRYILKRWT  600
KDARLGRARN SNDFAAQENP KLVVANRYKD LCRNILKMSA RAAESEDAFQ FSLRKLDELI  660
EGAEKVLMLK PDEGQGIYSS STIVNGHESE NAEVFLNEKA IEDQGEDNRV EDQKKGRVMF  720
LIDIN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G139300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011041602.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A2K1XMP50.0A0A2K1XMP5_POPTR; Uncharacterized protein
STRINGPOPTR_0015s13560.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-112FAR1-related sequence 5