PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G136000.1
Common NamePOPTR_0015s13860g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 717aa    MW: 78285.3 Da    PI: 9.4611
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G136000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.77e-25215268155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kp+++Wt+ LH+rF++a++++ G +kA+Pk+ile+m+v+gL++e+v+SHLQkYR+
  Potri.015G136000.1 215 KPKVVWTNSLHSRFLQAINHI-GLDKAVPKRILEFMSVPGLSRENVASHLQKYRI 268
                         79*******************.********************************6 PP

2Response_reg647.3e-22201361109
                         EEEESSSHHHHHHHHHHHH........HTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTT CS
        Response_reg   1 vlivdDeplvrellrqale........kegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahg 81 
                         +l+vdD+ + ++++  +l+        k ++  v +++++ +al +l+ k+  +Dl+++D+ mp+m+G+el ++  ee  klp+i++++ +
  Potri.015G136000.1  20 ILVVDDDSTSLSIVSAMLKtcsykenrKLEL-FVVTVKNPFDALSTLRLKKglFDLVVTDLHMPEMNGMELQQQVDEEF-KLPVIIMSSDD 108
                         89****************9665543222222.4889***********888889**********************9999.9********** PP

                         THHHHHHHHHTTESEEEESS--HHHHHH CS
        Response_reg  82 eeedalealkaGakdflsKpfdpeelvk 109
                         +e+ +l+ l+ Ga  +++Kp+++++l +
  Potri.015G136000.1 109 SEKVILRTLEGGAAFYIVKPINKDDLKN 136
                         *************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.4E-3117149No hitNo description
SMARTSM004487.2E-2418138IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521728.11E-2718144IPR011006CheY-like superfamily
PROSITE profilePS5011036.28319142IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.5E-1920136IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.32E-2221141No hitNo description
Gene3DG3DSA:3.40.50.23001.4E-31196215No hitNo description
SuperFamilySSF466891.24E-18212272IPR009057Homeodomain-like
PROSITE profilePS5129410.188212271IPR017930Myb domain
TIGRFAMsTIGR015574.0E-25215268IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.5E-25216272IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MASSQSSNII QNSSLLKIKI LVVDDDSTSL SIVSAMLKTC SYKENRKLEL FVVTVKNPFD  60
ALSTLRLKKG LFDLVVTDLH MPEMNGMELQ QQVDEEFKLP VIIMSSDDSE KVILRTLEGG  120
AAFYIVKPIN KDDLKNVWQY AVATKTGKYS LSIKEIGGSQ ESSSSTVFDQ KISVDEVSSA  180
KSTNIKICNE KDRINKNRKR TKEDQEVDSQ LAPKKPKVVW TNSLHSRFLQ AINHIGLDKA  240
VPKRILEFMS VPGLSRENVA SHLQKYRIFL KKVAERGTSS SKNLSGRALK SNFASSQPSL  300
MLKNFQQEYS QFSRQQQVLR ASVQAGFGGN TIPTPDGGSN FGSLHSPNQQ APNNNSALQS  360
PYKQSRSFGN PTGFQQLSFG NANQANKKRS GLESNNNTGT NPPASRESVP NGLTHGKSPM  420
QIYQPQNQGR SNLQSFDSSE HNKFGSIGVQ ATNYRSGVGN IGNNNNSLNT NNNYAGIRVN  480
TDGQLIGAGQ LQVSKNKLSN GFGNGGNCGL MNWTHNGNMN VASSSYLAQR GSFPASIESA  540
NQFPPTLFTS TVYQGNTPML LPPPPPPPQQ QQQLGLGNGG QHDFAFGLVN NSPPIFGGNY  600
NQQQQFGQGE LNFSDMLLEP TNNLTAHQPQ GVDQVSTPLH DLLHPDFLNS LHIDDNTPWN  660
EQPSSQVQSG EEAMNPFFGG NASSMDGYFP NFNQASVRHT NIAALILSIV FTISNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-22212274264ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G136000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322438.20.0two-component response regulator ARR1
TrEMBLB9ID110.0B9ID11_POPTR; Uncharacterized protein
STRINGPOPTR_0015s13860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101422534
Representative plantOGRP1212546
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07210.13e-64response regulator 21