PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G106900.1
Common NameFL, POPTR_0015s11820g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LFY
Protein Properties Length: 378aa    MW: 42595.2 Da    PI: 8.374
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G106900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY621.81.2e-18913631386
             FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmk 91 
                         mdpeaf+aslfkwd+ra++ + p+rlle    +++p +aa a+  r+l +leelf+ayG+ry+t+akiaelGftv+tL+dmkdeeld++m+
  Potri.015G106900.1   1 MDPEAFTASLFKWDTRAMV-PHPNRLLEMVPPPQQPPAAAFAVRPRELCGLEELFQAYGIRYYTAAKIAELGFTVNTLLDMKDEELDEMMN 90 
                         9**************9766.77789988888888887778888888899****************************************** PP

             FLO_LFY  92 slseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeet.aldalsqeglseepvqeekeaagsggeglgeaelvaaeekks 181
                         sls+ifr+dllvGeryGikaavraerrrl+ee+   +rr+lls d++t +ldalsqeg seepvq+ keaagsgg+g  ++e+vaa e   
  Potri.015G106900.1  91 SLSQIFRWDLLVGERYGIKAAVRAERRRLDEED--PRRRQLLSGDNNTnTLDALSQEGFSEEPVQQDKEAAGSGGRG--TWEAVAAGE--- 174
                         *******************************88..88888998887666************************9998..999999983... PP

             FLO_LFY 182 eeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiake 272
                            +kk+s    ++k ++++          + d d+e +g    erqrehPfivtepgevargkknGLDYLf+LyeqCr+fL+qvq+iake
  Potri.015G106900.1 175 ---RKKQSG---RKKGQRKV---V------DLDGDGE-HGGAICERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQSIAKE 249
                         ...333312...22222221...1......1222333.444467*********************************************** PP

             FLO_LFY 273 rGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahp 363
                         rGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLde+asnalrrafkergenvGawrqacykplvaia+rqgwdid++fnahp
  Potri.015G106900.1 250 RGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGAWRQACYKPLVAIASRQGWDIDSIFNAHP 340
                         ******************************************************************************************* PP

             FLO_LFY 364 rLsiWYvPtkLrqLChlerskas 386
                         rL+iWYvPtkLrqLC++er++a+
  Potri.015G106900.1 341 RLAIWYVPTKLRQLCYAERNSAT 363
                         *******************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.5E-2061362IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MDPEAFTASL FKWDTRAMVP HPNRLLEMVP PPQQPPAAAF AVRPRELCGL EELFQAYGIR  60
YYTAAKIAEL GFTVNTLLDM KDEELDEMMN SLSQIFRWDL LVGERYGIKA AVRAERRRLD  120
EEDPRRRQLL SGDNNTNTLD ALSQEGFSEE PVQQDKEAAG SGGRGTWEAV AAGERKKQSG  180
RKKGQRKVVD LDGDGEHGGA ICERQREHPF IVTEPGEVAR GKKNGLDYLF HLYEQCRDFL  240
IQVQSIAKER GEKCPTKVTN QVFRYAKKAG ASYINKPKMR HYVHCYALHC LDEDASNALR  300
RAFKERGENV GAWRQACYKP LVAIASRQGW DIDSIFNAHP RLAIWYVPTK LRQLCYAERN  360
SATSSSSVSG TGGHLPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1092033734186PROTEIN LEAFY
2vy2_A1e-1092033734186PROTEIN LEAFY
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.115600.0bud| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: In developing inflorescences, leaf primordia and very young leaves.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G106900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX2798850.0KX279885.1 Populus alba cultivar 6K10 LEAFY transcription factor (LFY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322307.20.0floricaula/leafy homolog
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLA0A2K1XL670.0A0A2K1XL67_POPTR; Uncharacterized protein
STRINGPOPTR_0015s11820.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80333346
Representative plantOGRP70181619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-151floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Rottmann WH, et al.
    Diverse effects of overexpression of LEAFY and PTLF, a poplar (Populus) homolog of LEAFY/FLORICAULA, in transgenic poplar and Arabidopsis.
    Plant J., 2000. 22(3): p. 235-45
    [PMID:10849341]
  2. Tuskan GA, et al.
    The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
    Science, 2006. 313(5793): p. 1596-604
    [PMID:16973872]