PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G093600.2
Common NamePOPTR_0015s10570g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 868aa    MW: 96043.1 Da    PI: 8.5119
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G093600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix51.52.7e-16798862165
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkik 65 
                         +W+ +ev+ Li++r e+++r++  + +++lWee+s ++++ g++ sp qCk  w +l+k+y+ + 
  Potri.015G093600.2 798 KWKPEEVKSLIKMRGELHSRFQVVRGRMALWEEISTNLMADGINHSPGQCKYLWTSLAKKYEVCS 862
                         7************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.60.15.109.5E-6981331IPR001279Metallo-beta-lactamase
SuperFamilySSF562818.42E-7182496IPR001279Metallo-beta-lactamase
SMARTSM008495.7E-2594291IPR001279Metallo-beta-lactamase
PfamPF127062.7E-11106241IPR001279Metallo-beta-lactamase
PfamPF075211.3E-5439468IPR011108Zn-dependent metallo-hydrolase, RNA specificity domain
PROSITE profilePS500907.248791855IPR017877Myb-like domain
PfamPF138378.0E-12796861No hitNo description
CDDcd122031.66E-18797859No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 868 aa     Download sequence    Send to blast
MAAAFSALSI SPYTLVCRHN STKHSISCST ASPTTTTIGS RGTKAPPRHK RSERMEGAGK  60
SMEDSVKRKM EQFYEGSDGP PLRIVPIGGL GEIGMNCMLV GNFDRYILID AGVMFPDYDE  120
LGVQKIIPDT TFIRRWRHKI EAVIITHGHE DHIGALPWVI PALDHHTPIY ASSFTMELIK  180
KRLKENGIFV PSRLKVFKTK RKFAAGPFEI EPIRVTHSIP DCCGLVLRCA DGTILHTGDW  240
KIDESPLDGK KFDRETLEEL SKEGVTLMMS DSTNILSPGR TISESVVADA LLRRISAAKG  300
RIITTQFASN IHRLGSVKAA ADLTGRKMVF VGMSLRTYLD AAWKDGKAPI DPSTLVKVED  360
IDAYAPKDLL IVTTGSQAEP RAALNLASYG SSHALKLNKE DVILYSAKVI PGNESRVMKM  420
MNRISEIGST IVIGKNELLH TSGHGYRGEL EEVLKIVKPQ HFLPIHGELL FLKEHELLGK  480
STGIQHTTVI KNGEMLGVSH LRNRRVLSNG FVFLGKENLQ LMYNDGDKAF GTSTELCVDE  540
RMRIATDGIV VVSMEILRPQ NADGLVENSL KGKIKITTRC LWLDKGKLLD ALHKAAHAAL  600
SSCPVNCPLA HMERTVSEVL RKMVRKYSGK RPEVIAVAME NPAAVLSDEL NAKLSGNSHV  660
GLGISALRKM ADGHKKKIRV DRKQPDGNGY ANLEKTSTQN SEVDGFEFER ELSKEEETSS  720
SPSLAEGHSS DSENQDDFRK SFIPPSPVNE LVKSDEDLVP PWEHVNELKE DGTISSDDDS  780
LENQNSRSKG SRPVKRNKWK PEEVKSLIKM RGELHSRFQV VRGRMALWEE ISTNLMADGI  840
NHSPGQCKYL WTSLAKKYEV CSSISYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5a0t_A3e-858264019560RIBONUCLEASE J
5a0t_B3e-858264019560RIBONUCLEASE J
5a0v_A3e-858264019560RIBONUCLEASE J
5a0v_B3e-858264019560RIBONUCLEASE J
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1667683RKMADGHKKKIRVDRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.120090.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321691.20.0hypothetical protein POPTR_0015s10570g
TrEMBLB9IF880.0B9IF88_POPTR; Uncharacterized protein
STRINGPOPTR_0015s10570.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63420.10.0Trihelix family protein