PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G077800.1
Common NamePOPTR_0015s08890g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 237aa    MW: 26554.7 Da    PI: 8.5777
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G077800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF497.8e-162368550
                        SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        nk  + v+fskR+ ++ KK eEL +LC++ ++++ f+++g++ +y+
  Potri.015G077800.1 23 NKETQAVSFSKRKPTLKKKVEELKTLCAVTICMVCFGPDGTVETYP 68
                        788899***************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-4970IPR002100Transcription factor, MADS-box
CDDcd001202.43E-141068No hitNo description
SuperFamilySSF554551.2E-132388IPR002100Transcription factor, MADS-box
PfamPF003191.8E-142367IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.1012371IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MATKSQKTAT RREKFMKKIN EGNKETQAVS FSKRKPTLKK KVEELKTLCA VTICMVCFGP  60
DGTVETYPEN AAEVKREIGF YKGLHAMQKR EFNLLGYLEN VKGKLGLKRQ KVKRKKLEAL  120
AESFSNQIEG LSGDAFLHFI ETLEKKLMGL RGKIGDLLSI RGDKGQANAH GNDNTDHALV  180
PCDRAVPEPI DANNRIFMVE NMCANPIVDE DLAEYFWDSE LLKLAGFECQ PITPEQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G077800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321604.31e-176agamous-like MADS-box protein AGL103
TrEMBLA0A2K1XJN61e-175A0A2K1XJN6_POPTR; Uncharacterized protein
STRINGPOPTR_0015s08890.11e-174(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1616059
Representative plantOGRP1213926
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02235.13e-07AGAMOUS-like 51