PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G069000.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 226aa    MW: 25546.8 Da    PI: 9.9388
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G069000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.8e-12100144347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ +++ + ++ G+g+W+ I+r + k+R + q+ s+ qk+
  Potri.015G069000.2 100 PWTEEEHRRFLFGLQKVGKGDWRGISRNFVKTRNPTQVASHAQKH 144
                         8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.97793149IPR017930Myb domain
SuperFamilySSF466892.24E-1695150IPR009057Homeodomain-like
TIGRFAMsTIGR015579.2E-1596147IPR006447Myb domain, plants
SMARTSM007171.2E-797147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-1099144IPR009057Homeodomain-like
PfamPF002495.2E-9100144IPR001005SANT/Myb domain
CDDcd001671.38E-7100145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MVTGSSSTVS GGEGAAETKP KEIRLFGVRV VVDNFRRNVS LNNVTEYQYY KEMTPNTNND  60
NNNEEEDAGA AVSGYMSADD TVHRSSPASG RRSERKRGVP WTEEEHRRFL FGLQKVGKGD  120
WRGISRNFVK TRNPTQVASH AQKHFLRLNN VNRRRRRTSL FDITADTVAT SHHIPSHPIH  180
AIVLCHQLNC SKPLCIELVC LDFLNHRNLI SILILNLLIF YSLNF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152157RRRRRT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.31550.0bud| stem
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G069000.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2166844e-63AC216684.1 Populus trichocarpa clone POP030-A02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322138.11e-121transcription factor MYB1R1
SwissprotQ2V9B02e-44MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLB9IEJ91e-119B9IEJ9_POPTR; MYB-like family protein
STRINGPOPTR_0015s08020.11e-120(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.21e-36MYB_related family protein
Publications ? help Back to Top
  1. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]