PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G069000.1
Common NamePOPTR_0015s08020g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 319aa    MW: 35091.1 Da    PI: 10.3692
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G069000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.33.2e-12100144347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ +++ + ++ G+g+W+ I+r + k+R + q+ s+ qk+
  Potri.015G069000.1 100 PWTEEEHRRFLFGLQKVGKGDWRGISRNFVKTRNPTQVASHAQKH 144
                         8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.97793149IPR017930Myb domain
SuperFamilySSF466894.11E-1695150IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-1496147IPR006447Myb domain, plants
SMARTSM007171.2E-797147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-1099144IPR009057Homeodomain-like
PfamPF002499.0E-9100144IPR001005SANT/Myb domain
CDDcd001673.31E-7100145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MVTGSSSTVS GGEGAAETKP KEIRLFGVRV VVDNFRRNVS LNNVTEYQYY KEMTPNTNND  60
NNNEEEDAGA AVSGYMSADD TVHRSSPASG RRSERKRGVP WTEEEHRRFL FGLQKVGKGD  120
WRGISRNFVK TRNPTQVASH AQKHFLRLNN VNRRRRRTSL FDITADTLTS LPKEEQQAHR  180
QDSNINNHAS PSNPLPPPPL QANSITNFSG VPSIPIRTVN PSVLPLQIEN PMMESQSLGQ  240
GHQFINHSTN LVRPVAVVPA VCTPAMPDLN LNLKPTADSS SLSLKLSSPF VQRESTSRSS  300
AFQAMSSMKN GDNTITVA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152157RRRRRT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.31550.0bud| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G069000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1459421e-149EF145942.1 Populus trichocarpa clone WS0114_H05 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322138.10.0transcription factor MYB1R1
TrEMBLB9IEJ90.0B9IEJ9_POPTR; MYB-like family protein
STRINGPOPTR_0015s08020.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42483154
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.22e-38MYB_related family protein