PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G066700.1
Common NamePOPTR_0015s07780g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 272aa    MW: 30740.4 Da    PI: 5.514
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G066700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.23.3e-3910106197
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCa+Ck++rrkC+++C+lapyfp +qp+ f+n+hklFG++++lk+l++l+++++e+am+s++y+A++r r Pv+G+ g+i kl+ q++q++
  Potri.015G066700.1  10 ACASCKYQRRKCSPECPLAPYFPPDQPRLFQNTHKLFGVRKILKILENLDPHQHEEAMRSIIYQANIRDRFPVHGCWGIICKLHFQIRQAE 100
                         7****************************************************************************************** PP

              DUF260  92 aelall 97 
                         +el ++
  Potri.015G066700.1 101 EELRAV 106
                         **9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5389110IPR004883Lateral organ boundaries, LOB
PfamPF031956.5E-3710105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MTLKGGTSQA CASCKYQRRK CSPECPLAPY FPPDQPRLFQ NTHKLFGVRK ILKILENLDP  60
HQHEEAMRSI IYQANIRDRF PVHGCWGIIC KLHFQIRQAE EELRAVLAHL EMYRQQQHQH  120
QIAALTEDVP SQLELGMAPP QPCLAQQYSY SIVGSNTGYS SNYLDSNDNA GNSLWGQHPY  180
ATNYNINSMP IIQSQLAASQ PLATQQEIVQ DYDEMHPFFD SIDDRQSYIE TKEPYESSSE  240
ESLKDTAPSM EHAAENELKS AAACFSLTSI N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-3061147113LOB family transfactor Ramosa2.1
5ly0_B8e-3061147113LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.127140.0bud| catkin
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G066700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321540.10.0LOB domain-containing protein 27
SwissprotQ9STS62e-58LBD27_ARATH; LOB domain-containing protein 27
TrEMBLB9IEH60.0B9IEH6_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.19e-61LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]