PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G065400.3
Common NamePOPTR_0015s07640g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 269aa    MW: 30935 Da    PI: 4.3801
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G065400.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.91.9e-194093356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        k++++t +q++ Le+ Fe ++++  e++ +LAk lgL+ rqV +WFqNrRa++k
  Potri.015G065400.3 40 KKRRLTVDQVQFLEKSFELENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWK 93
                        56689************************************************9 PP

2HD-ZIP_I/II129.41.4e-4139130192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ +qv++LE+sFe e+kLeperK +la++Lglqprqva+WFqnrRAR+ktkqlEkdy++L+++y++lk++ ++L ke+e+L++e+
  Potri.015G065400.3  39 EKKRRLTVDQVQFLEKSFELENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQSSYNSLKADYDNLLKEKEKLKAEV 129
                         69**************************************************************************************998 PP

         HD-ZIP_I/II  92 k 92 
                         +
  Potri.015G065400.3 130 N 130
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.27E-202397IPR009057Homeodomain-like
PROSITE profilePS5007117.3943595IPR001356Homeobox domain
SMARTSM003892.3E-193899IPR001356Homeobox domain
PfamPF000468.3E-174093IPR001356Homeobox domain
CDDcd000869.00E-184096No hitNo description
Gene3DG3DSA:1.10.10.605.5E-2042103IPR009057Homeodomain-like
PRINTSPR000311.0E-56675IPR000047Helix-turn-helix motif
PROSITE patternPS0002707093IPR017970Homeobox, conserved site
PRINTSPR000311.0E-57591IPR000047Helix-turn-helix motif
PfamPF021835.8E-1795136IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MMSFEDVHQA NGSTRPFFRS FDHEDNGDDD LDEYFHQPEK KRRLTVDQVQ FLEKSFELEN  60
KLEPERKIQL AKDLGLQPRQ VAIWFQNRRA RWKTKQLEKD YDVLQSSYNS LKADYDNLLK  120
EKEKLKAEVN LLTDKLLLKE KEKGISELSD KDALSQEPPK RAIADSASEG EVSKISTVAC  180
KQEDISSAKS DIFDSDSPHY ADGVHSSLLE AGDSSYVFEP DQSDLSQDEE DNFSKSLLPP  240
YVFPKLEDDD YSDPPASFED HAFWSWSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18795RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.172740.0leaf| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G065400.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1478220.0EF147822.1 Populus trichocarpa clone WS0125_E07 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321530.20.0homeobox-leucine zipper protein HAT5
TrEMBLA9PHH00.0A9PHH0_POPTR; HD-ZIP family protein
STRINGPOPTR_0015s07640.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-40homeobox 1
Publications ? help Back to Top
  1. Ralph SG, et al.
    Analysis of 4,664 high-quality sequence-finished poplar full-length cDNA clones and their utility for the discovery of genes responding to insect feeding.
    BMC Genomics, 2008. 9: p. 57
    [PMID:18230180]