PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G065400.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 303aa    MW: 34175.1 Da    PI: 8.7525
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G065400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.72.3e-1986139356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++t +q++ Le+ Fe ++++  e++ +LAk lgL+ rqV +WFqNrRa++k
  Potri.015G065400.2  86 KKRRLTVDQVQFLEKSFELENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWK 139
                         56689************************************************9 PP

2HD-ZIP_I/II129.11.8e-4185176192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ +qv++LE+sFe e+kLeperK +la++Lglqprqva+WFqnrRAR+ktkqlEkdy++L+++y++lk++ ++L ke+e+L++e+
  Potri.015G065400.2  85 EKKRRLTVDQVQFLEKSFELENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQSSYNSLKADYDNLLKEKEKLKAEV 175
                         69**************************************************************************************998 PP

         HD-ZIP_I/II  92 k 92 
                         +
  Potri.015G065400.2 176 N 176
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.84E-2069143IPR009057Homeodomain-like
PROSITE profilePS5007117.39481141IPR001356Homeobox domain
SMARTSM003892.3E-1984145IPR001356Homeobox domain
PfamPF000461.0E-1686139IPR001356Homeobox domain
CDDcd000862.32E-1786142No hitNo description
Gene3DG3DSA:1.10.10.606.8E-2088149IPR009057Homeodomain-like
PRINTSPR000311.2E-5112121IPR000047Helix-turn-helix motif
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5121137IPR000047Helix-turn-helix motif
PfamPF021836.6E-17141182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MAGGTGGSNS NLSVLLQSQR GPCAASQPLE SFFLSGSSPS FLGSRSMMSF EDVHQANGST  60
RPFFRSFDHE DNGDDDLDEY FHQPEKKRRL TVDQVQFLEK SFELENKLEP ERKIQLAKDL  120
GLQPRQVAIW FQNRRARWKT KQLEKDYDVL QSSYNSLKAD YDNLLKEKEK LKAEVNLLTD  180
KLLLKEKEKG ISELSDKDAL SQEPPKRAIA DSASEGEVSK ISTVACKQED ISSICHKMKK  240
ITLARAYCLH TSFRSLKMTI TLTRLQVLKI MPFGPGHTKL HLVYIIVCYS SCLLAASYAL  300
KQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.172740.0leaf| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G065400.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1478220.0EF147822.1 Populus trichocarpa clone WS0125_E07 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321530.21e-168homeobox-leucine zipper protein HAT5
SwissprotQ022837e-47HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA9PHH01e-167A9PHH0_POPTR; HD-ZIP family protein
STRINGPOPTR_0015s07640.11e-168(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-39homeobox 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Arce AL,Chan RL
    A uORF Represses the Transcription Factor AtHB1 in Aerial Tissues to Avoid a Deleterious Phenotype.
    Plant Physiol., 2017. 175(3): p. 1238-1253
    [PMID:28956754]