PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G060400.1
Common NamePOPTR_0015s07140g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 562aa    MW: 61613.6 Da    PI: 8.1587
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G060400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.33.5e-41176251277
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         Cqv +C++dls+ keyh+rhkvCevhs++++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Potri.015G060400.1 176 CQVYDCNKDLSSSKEYHKRHKVCEVHSRTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 251
                         **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.8E-32170237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-38174253IPR004333Transcription factor, SBP-box
PfamPF031105.0E-31176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MESGSYVLGG KGHVSNEPTS SSDTFSRSKN VLMSCDLKNQ CNFEYNFLAS GSQAIENGAR  60
GELGYQQLIE KHAPDTSIRN ALISEVSGRK NINPFVVTPN SFSLEDESTS RLSSTAMDSD  120
CRVSAFIDLN LGRFGDPRDV QNCRRIPKST SIVSPSKSSA PPRRHRAGMN SHTAYCQVYD  180
CNKDLSSSKE YHKRHKVCEV HSRTAKVIVN GIEQRFCQQC SRFHLLAEFD DGKRSCRKRL  240
AGHNERRRKP QVGLQSGRTG RLLHPYSGFS SSRFHETVLP TTSFICQDIL QSGLSHPDKY  300
GANDWCKRVK IEDGTGFSPP SAIPITNAYL HSKPLFPSNN SEKMFPTFHE DGASTASGSI  360
FNESTHRYPD VMGCRTSSSH SFLQDTSLGN DEFAAFDAAS TIQELSGITA SGCARSLLSS  420
QSQNSSSHSS GIPMAQQLLV SCRNTCYSMD QIIGVSSQVS SSTGVPNKFP SWVTSSVKGS  480
HLGPMPIPEN SHVVNFDITD GVYHGFNAKD HFGSEDDTTI DLLQLSSQLQ RVEHQKQSMQ  540
EKQEMILSAA PASLKKASKF L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-291762491184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G060400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006374432.10.0squamosa promoter-binding-like protein 18
TrEMBLA0A385JIN00.0A0A385JIN0_POPTO; Squamosa promoter-binding protein-like
TrEMBLU5FPU60.0U5FPU6_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07140.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-42SBP family protein