PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G047700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family bZIP
Protein Properties Length: 210aa    MW: 23868.9 Da    PI: 9.1139
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G047700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.61.3e-13110168563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         k+ rr+++NRe+ArrsR R+k++ie L+ +v +L++ N++L +++ +l +   +  +e+
  Potri.015G047700.1 110 KKLRRMISNRESARRSRMRRKKQIEDLQYRVNQLQNMNHQLSEKVIHLLESNHQTLQEN 168
                         899*****************************************999988888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-13106170IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.955108171IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.6E-12108163No hitNo description
SuperFamilySSF579593.31E-11110161No hitNo description
PfamPF001703.6E-12110168IPR004827Basic-leucine zipper domain
CDDcd147027.89E-16111162No hitNo description
PROSITE patternPS000360113128IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MEPHEIKKFH GLPQENLVHN LFTFPNPIQK QYPSAASLKM QPIVESTNHT PTQANISENP  60
ESSSSLFDKF LINSLIHVPL HIPSPNTSSV STDSTLAEPR DQQLGISNEK KLRRMISNRE  120
SARRSRMRRK KQIEDLQYRV NQLQNMNHQL SEKVIHLLES NHQTLQENSQ LKEKVSSLQV  180
VLSDLLTPLR NVDDGDCNGI HLKGETSNR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G047700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321470.31e-151basic leucine zipper 8
TrEMBLA0A2K1XI231e-150A0A2K1XI23_POPTR; Uncharacterized protein
STRINGPOPTR_0015s03580.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Representative plantOGRP1181045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.16e-22basic leucine-zipper 70