PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G041500.1
Common NamePOPTR_0015s04260g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 1245aa    MW: 139142 Da    PI: 8.0806
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G041500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding262.1e-08455498346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +WT  Ed+ l+  v++ G  +W  Ia  +g++Rt+ qc sr+q 
  Potri.015G041500.1 455 PWTIKEDKNLLLNVQEKGVTNWFDIAVSLGTNRTPSQCLSRFQR 498
                         8*****************************************96 PP

2Myb_DNA-binding36.21.4e-11507552248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           WT+eEd +l  av+ +G ++W ++a t+  gR + qc +rw k l
  Potri.015G041500.1 507 REWTKEEDAQLRIAVETYGERDWQSVACTLE-GRAGTQCSNRWKKTL 552
                         68*****************************.***********9975 PP

3Myb_DNA-binding53.17.4e-17560604247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         grWT +Ed++l+ avk++G++ W++Ia+ ++ gRt  qc++rw + 
  Potri.015G041500.1 560 GRWTLDEDKRLKVAVKLFGPKKWDKIAQFVP-GRTQVQCRERWVNC 604
                         8******************************.***********986 PP

4Myb_DNA-binding46.21e-14611654146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         r+ WT+eEd++l+ a+++ G   W+++a++++  Rt++qc  rw  
  Potri.015G041500.1 611 RDEWTEEEDLRLKAAIEECGYC-WSKVAERLP-QRTDNQCLRRWKV 654
                         789*****************99.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.935349447IPR017877Myb-like domain
SMARTSM007171.3353449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-7356372IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-7420460IPR009057Homeodomain-like
SuperFamilySSF466892.21E-14428498IPR009057Homeodomain-like
SMARTSM007173.5E-7452502IPR001005SANT/Myb domain
PROSITE profilePS500908.444452500IPR017877Myb-like domain
CDDcd001674.48E-6455500No hitNo description
PfamPF139211.9E-10456517No hitNo description
Gene3DG3DSA:1.10.10.601.4E-11461508IPR009057Homeodomain-like
SuperFamilySSF466898.64E-18485558IPR009057Homeodomain-like
PROSITE profilePS5129421.328501556IPR017930Myb domain
SMARTSM007178.1E-9505554IPR001005SANT/Myb domain
CDDcd001671.38E-8508552No hitNo description
Gene3DG3DSA:1.10.10.607.9E-16509558IPR009057Homeodomain-like
PROSITE profilePS5129414.793557605IPR017930Myb domain
SMARTSM007175.3E-15558607IPR001005SANT/Myb domain
SuperFamilySSF466891.07E-26559652IPR009057Homeodomain-like
PfamPF002492.4E-15560604IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-21560610IPR009057Homeodomain-like
CDDcd001673.12E-13561603No hitNo description
PROSITE profilePS5129423.606606660IPR017930Myb domain
SMARTSM007176.6E-13610658IPR001005SANT/Myb domain
PfamPF002494.8E-13611654IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-18611655IPR009057Homeodomain-like
CDDcd001672.60E-11613656No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1245 aa     Download sequence    Send to blast
MKAFSLESPP QFFSLNPKKF LHTPSCDHTM SRFRRPNDDD EEEEEDDDDD FQNDMEALRQ  60
ACLLTGTNLT NISPSAAVSD GSGEADGNSC GGASVSDSGS EDDFELFRSV QNRFATSANS  120
LEPLSLKPLC ALPPVSDDEE DDFETLCAVK RRFAAYDNNN NQEKLKTEME KSEVGVSDNS  180
LAERNTACEV LPVTEQDDNA ANLLGDNVEI GNSASAEENE LDSGRLSTLE LDYSSFPKSA  240
QVFIDAIKRN RSCQKFIQNK LIQIEARIEE NNKLKDKVKI LKDFQFSCRK ITGMALSLRK  300
DPRIQLVSAR KTSNSKHPKV NGKKVSPLQD GPVENSHVAN YRTALTNFPL SLNRKKWTET  360
EKENLGKGIR QQFQEMMLQF SMDQFSSEGS PEDGKNLDSI LVSIRDLEIT PEKIREFLPR  420
VNWDQLASSY VAGRSGAECE ARWLNFEDLL INQSPWTIKE DKNLLLNVQE KGVTNWFDIA  480
VSLGTNRTPS QCLSRFQRSL NARILKREWT KEEDAQLRIA VETYGERDWQ SVACTLEGRA  540
GTQCSNRWKK TLHPAIRRVG RWTLDEDKRL KVAVKLFGPK KWDKIAQFVP GRTQVQCRER  600
WVNCLDPSMN RDEWTEEEDL RLKAAIEECG YCWSKVAERL PQRTDNQCLR RWKVLVPHEV  660
PLLQAARRMQ KAALISNFVD RESERPALGP NDFVPLAITG PVSDPEKMDQ SRKRKRKLRR  720
EESQMEKVAA PGNASKKIRS NRSRKKVQIS SKEVPEIPDG TQVGNLGGSR SVVTETTMEY  780
CSENNRHAER GQDHPSSNSN LTPLMTTSFQ GVDSGQNQQL PDLHPKGRKP VDRDGNSKSL  840
LLSPPENLDA GIINGDVSQT FHPNSTTSSK KRRAYKQHSR KNICAKSSEG SSVLSETTID  900
ASALVNDYLD SNLVTTNEED NILGQRDAPG KKRVPKLHSE SSEWTGSLDC LLPPHENSEL  960
RVTSTEIMNK SSLFGTPTNE KRKAFKLPCR RKIRNEEPSR KDQCFAAVPC QQDTSKKSKA  1020
RGKSCSKKVL ETKNEDDVVL ASFLRDKSKK KRLKVAQNAD QACSSSSMIT RPEVLSRVDQ  1080
PSNGNKLSSA VRNSEGQTCS HGRSSENGLS CDMYAHQSNH MQTERCELDV NNRGIFAPME  1140
GVREPGSIDQ EAVLEPGDIS PAGSGSRVNT HSHSRKGPQL HSKGAEQPRN DTGPDKLSCS  1200
VKNSIGSSSK PTIIGNDIEP GGRSSHSPSA SGEALKYYKR RSKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-314256524155MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-314256524155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1711716RKRKRK
2711719RKRKRKLRR
3713720RKRKLRRE
412341240LKYYKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322121.20.0hypothetical protein POPTR_0015s04260g
TrEMBLB9IEF20.0B9IEF2_POPTR; Uncharacterized protein
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP73551617
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1