PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G039100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 375aa    MW: 42333.8 Da    PI: 7.1031
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G039100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.34e-2183142357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         +R+++t+eql++Le+l+++ +r+ps++++++++++l    +++ ++V++WFqN++a+e++
  Potri.015G039100.1  83 SRWNPTPEQLRTLEDLYRRgTRTPSTDQIQDITAQLrrygRIEGKNVFYWFQNHKARERQ 142
                         7*****************99**************************************97 PP

2Wus_type_Homeobox1153.6e-3782144365
   Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         ++RW+PtpeQ++ Le+ly++G+rtP++++iq+ita+L++yG+ie+kNVfyWFQN+kaRerqk+
  Potri.015G039100.1  82 SSRWNPTPEQLRTLEDLYRRGTRTPSTDQIQDITAQLRRYGRIEGKNVFYWFQNHKARERQKR 144
                         79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.5E-580147IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-883142IPR009057Homeodomain-like
SuperFamilySSF466893.89E-1283148IPR009057Homeodomain-like
PfamPF000469.6E-1983142IPR001356Homeobox domain
CDDcd000866.55E-684144No hitNo description
PROSITE profilePS5007110.94888143IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MWMMGYNDGG EFNISDSFNG RKLRPLVPRP IPSTNNTPTA SSPPCLGSRL HNTDFFALNQ  60
YHLASMADQN KREFNTQPVV MSSRWNPTPE QLRTLEDLYR RGTRTPSTDQ IQDITAQLRR  120
YGRIEGKNVF YWFQNHKARE RQKRRRQMES DSFDGHLQNG HGIEIFERKE SEASRTGYEG  180
EQTKNWAPST NCSTLSEESV SISRATKGAM AEYCRPDGWM QLDEGELQHR RNFIERNATW  240
EMMQLSCPSP THQRNTISST SSTTTMSKQG AAAAKLIKAH DLNVFIAPYR ENGHHGALIN  300
QFNSSVINDG DESRGGTGES QTLQLFPLRS GGDGNNNIES INERESEVSV SAAEALNANN  360
FAPCQFFEFL PLKH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G039100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827000.0KF982700.1 Populus tomentosa WOX1b (WOX1b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024442258.10.0WUSCHEL-related homeobox 1
TrEMBLA0A2K1XHN20.0A0A2K1XHN2_POPTR; Uncharacterized protein
STRINGPOPTR_0015s04520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Representative plantOGRP8416716
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.13e-60WUSCHEL related homeobox 1