PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G032700.1
Common NamePOPTR_0015s05220g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 191aa    MW: 21436.7 Da    PI: 6.6206
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G032700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer93.61.7e-29961559
         ZF-HD_dimer  5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                         YkeCl+NhAaslG++a+DGCgEf+ +  +++++ +l+CaACgCHRnFHR+ + +
  Potri.015G032700.1  9 LYKECLRNHAASLGSYATDGCGEFTLD--DTSSPYSLQCAACGCHRNFHRKVTYS 61
                        7*************************8..5578******************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-24959IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.1481058IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-241057IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257744.0E-181057IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.608.9E-28103169IPR009057Homeodomain-like
SuperFamilySSF466893.59E-16104168IPR009057Homeodomain-like
TIGRFAMsTIGR015651.7E-29110168IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MESDNTNDLY KECLRNHAAS LGSYATDGCG EFTLDDTSSP YSLQCAACGC HRNFHRKVTY  60
SNSSNRRDHI MHPPSSETVV MEMIDYAEGN NERDFRPPVM VVESGERSGK KRYRTKFTPE  120
QKEKMLGFAE KLGWKLQRKD EEDEVESFCR GIGISRQVFK VWMHNHKNSS SSTSASTGNA  180
SSLTTQEEGG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-211111731879ZF-HD homeobox family protein
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, inflorescences, open flowers and seeds. Detected in stems and seedlings. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the up-regulation of several stress-inducible genes. Acts as a transcriptional activator by interacting with MED25 and NAC proteins. Involved in increased drought tolerance. {ECO:0000269|PubMed:16428600, ECO:0000269|PubMed:17233795}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G032700.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by abscisic acid and by drought and salt stress. Not induced by cold. {ECO:0000269|PubMed:17233795}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006374228.21e-143zinc-finger homeodomain protein 10
SwissprotQ9SEZ16e-40ZHD11_ARATH; Zinc-finger homeodomain protein 11
TrEMBLA0A2K1XHC61e-142A0A2K1XHC6_POPTR; Uncharacterized protein
STRINGPOPTR_0015s05220.11e-142(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79822844
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69600.16e-42zinc finger homeodomain 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]