PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G031600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 444aa    MW: 48363.6 Da    PI: 8.2585
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G031600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.1e-32259312255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Potri.015G031600.1 259 PRMRWTSSLHSRFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 312
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15256313IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28257313IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-24259312IPR006447Myb domain, plants
PfamPF002496.9E-7260311IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MSQKGIFDKQ SLNLIPDLSL HISLPNSAPS SICTGTNDGD SAFDIWRKDD GLIKSHSDSS  60
IRVGSQISDT ELSLANPTST AALEAESPWR INYGGRGTGG LEDHHPDQAR QRNLLLQRSS  120
NGQMSHINHG ISVLDVTGSK PIKGIPVYNS WNSSGDHNID PRFSFNQMPY SPSCTPYSSS  180
NSSADHHTST LQAYRMGTSA PRFNGMSMES LRVPQYHQYH QYGAAAGVGG GGAELYGSSG  240
MIRSRFMPKL HSKRNMRAPR MRWTSSLHSR FVHAVELLGG HERATPKSVL ELMDVKDLTL  300
AHVKSHLQMY RTVKSTDCRP TASSDGSGDE DFVSGTACIT QNATHLLNQK GGSKVLNLQH  360
DNGCPNSPTT LWSNSSSKGG WMRSSSRDLD GVRVETLPSQ QASGNKLEII AESRSFPGYN  420
QELKNPILEF SLGRPDGQNK EHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-17260314357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-17260314357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-17260314357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-17260314357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G031600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006374240.20.0transcription repressor KAN1
TrEMBLA0A2K1XH990.0A0A2K1XH99_POPTR; Uncharacterized protein
STRINGPOPTR_0015s05340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-52G2-like family protein