PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G030400.1
Common NamePOPTR_0015s05430g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 473aa    MW: 51921.8 Da    PI: 5.5662
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G030400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-1761104146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         r +WT+eE++++++a k++G g W++I +++g ++t+ q++s+ qk
  Potri.015G030400.1  61 REKWTEEEHQRFLEALKLYGRG-WRKIQEHVG-TKTAVQIRSHAQK 104
                         789*******************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.72E-1555108IPR009057Homeodomain-like
PROSITE profilePS5129421.4956110IPR017930Myb domain
TIGRFAMsTIGR015571.4E-1559108IPR006447Myb domain, plants
SMARTSM007171.1E-1360108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-1061103IPR009057Homeodomain-like
PfamPF002491.2E-1561104IPR001005SANT/Myb domain
CDDcd001679.40E-1263106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MAAAAKERIE GTKRNSFGEA SDCCSNGNEQ SEIVLQLNEL NSFGSDNIPK VRKPYTITKQ  60
REKWTEEEHQ RFLEALKLYG RGWRKIQEHV GTKTAVQIRS HAQKIFSKVV WESSGGNESS  120
LKPIEIPPPR PKRKPAHPYP RKSVDIRKGT PASSQLDGSP SPNSSASEKD NLSPTSVLSA  180
LASDTLGTAL SEQHNACSSP TSCTTDMHSI SLPPSVKEAE HLTSNSSREE DKETFSLIEM  240
SCSPLEKFLS KKFELGSDDT VCAEGDATKE ASSTSIKLFG MTVMVAASHK KSPPGAEFVL  300
SMTSNENQDN ADTDKEKPAQ TLLLKQSDTE LSLGMENSDQ NQLPSPASVF ECTELQRGTA  360
NYFATNPSIP WWFLGSGVSF LPPTSYDHTS TPTPTPSYMA ERSEEKEILN ERSCTGSNAG  420
PVGELENVEK SLDVVDSQCR QLPYKRCLGE RDVKSTVIVY EERERQRARV CS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G030400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006374255.10.0protein REVEILLE 7
RefseqXP_024442645.10.0protein REVEILLE 7
TrEMBLB9N3790.0B9N379_POPTR; Uncharacterized protein
STRINGPOPTR_0015s05430.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73133244
Representative plantOGRP12551549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.18e-50MYB_related family protein