PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G011800.1
Common NamePOPTR_0015s01410g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 257aa    MW: 29712.8 Da    PI: 6.3222
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G011800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.71.5e-25147195452
              RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          + le+++k+F++pi++AA+e++v+lTvLK++CR++ I+RWPhRkiksl
  Potri.015G011800.1 147 ALGLEEIQKHFNMPITQAAREMKVGLTVLKKRCRELKIMRWPHRKIKSL 195
                         5789*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.086130216IPR003035RWP-RK domain
PfamPF020421.0E-22148195IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MENPPDFDVW DLGVDDQDTF QKISELPPFE SLFDPSILLP LVPRDENINQ FKHLEDISSD  60
NIFSESNLES WYNQENAYID TKPVLNPGIH ASFGQNLDNN VIKGDHHLKG FSMLLVQSVC  120
ASSSSVKEEE EEEEESRKMS GRKRSVALGL EEIQKHFNMP ITQAAREMKV GLTVLKKRCR  180
ELKIMRWPHR KIKSLNSLIN NVKEMGLSEY DAIMLEEHKR LIEKLPDLEL TERTKKLRQA  240
CFKANYKRRR LSAAYH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1246250KRRRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G011800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321399.30.0protein RKD4
TrEMBLA0A2K1XGA60.0A0A2K1XGA6_POPTR; Uncharacterized protein
STRINGPOPTR_0015s01410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.19e-41RWP-RK domain-containing protein