PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G006200.3
Common NamePOPTR_0015s00860g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 412aa    MW: 45033.1 Da    PI: 8.2961
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G006200.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC771.9e-2458100244
                 WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                          epgrCrRtDGKkWRCsr+v ++kk+CErH+hrgr rsrk++e
  Potri.015G006200.3  58 LEPGRCRRTDGKKWRCSRDVAPDKKYCERHMHRGRPRSRKHVE 100
                         69***************************************97 PP

2QLQ49.51.3e-17840234
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34
                        +FT+aQ+++L++Q+++yKy++++  vPp+Ll +
  Potri.015G006200.3  8 PFTNAQWNELERQAMIYKYMVSSNHVPPHLLIP 40
                        8*****************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-11743IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-12840IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.585843IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.5557101IPR014977WRC domain
PfamPF088793.6E-2059100IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MAASLGFPFT NAQWNELERQ AMIYKYMVSS NHVPPHLLIP TPLMGNGLDV RFTKRADLEP  60
GRCRRTDGKK WRCSRDVAPD KKYCERHMHR GRPRSRKHVE LNTSSNSNSN KKSRHNPSIC  120
TESPVTVAIS NPTINNNNSS SASHDHFVGT MPQPYIQTPV FVNKTSEKIA TFDANGAFGS  180
TYKEPRSFDW MLKGGTGPIV TNDQQWPHLV HTEIGLATEG SFNNASVLKQ HYREESLNLN  240
SYGNLNARED QHRSQYSLFL DGAPRSYIDA WSNDANSGNT SSVSSDGKLP LSPLSLSMGG  300
NRSVDDEMGQ IQMGLGLIKP DQNQECGGDT SSTPGGPLAE VLQLRTVNIN TGTNQSSSVI  360
ENGDSICPPA TRVSSPSEVL QKTHASLSDS SGNRVQHLPV QGPNLKLPCF G*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G006200.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321965.20.0growth-regulating factor 4
TrEMBLA0A2K1XFZ80.0A0A2K1XFZ8_POPTR; Uncharacterized protein
TrEMBLA0A3N7G3550.0A0A3N7G355_POPTR; Uncharacterized protein
STRINGPOPTR_0015s00860.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.16e-36growth-regulating factor 7