PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G197800.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 1152aa    MW: 130365 Da    PI: 7.7565
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G197800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.37e-10553856
                        -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        ++ ql++L +++++++yps++++e+LA   +Lt +qV+ WF  +R  ek
  Potri.014G197800.2  5 SPLQLQALLKFYAEDKYPSQRAMEDLAVVSNLTFKQVRGWFIEKRRSEK 53
                        788******************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.726155IPR001356Homeobox domain
SMARTSM003892.0E-7159IPR001356Homeobox domain
SuperFamilySSF466892.27E-10357IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-9357IPR009057Homeodomain-like
CDDcd000861.51E-9356No hitNo description
PfamPF000461.9E-7553IPR001356Homeobox domain
SMARTSM005713.5E-11386445IPR018501DDT domain
PROSITE profilePS5082712.922386445IPR018501DDT domain
PfamPF027918.0E-10387442IPR018501DDT domain
PfamPF156123.8E-6667705IPR028942WHIM1 domain
PfamPF156131.5E-11800873IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1152 aa     Download sequence    Send to blast
MKRKSPLQLQ ALLKFYAEDK YPSQRAMEDL AVVSNLTFKQ VRGWFIEKRR SEKSKNELIE  60
PPRLTKKLSV FKGRKGAAVA SDARKMLKQL ELSASSTDKS NKPSSSKYKH APSEVQGRIG  120
KRKKKLVLVQ DLLTSDYILG KIFRKDGPPL GLEFDSLPTR AFHGCEDSRN SHPAHQENQR  180
ANKRGKVSMC AAFDDQNCNE SAPVKKHGMG KGLMTVWRVT NPDGGDFPTG IHCGGSQITV  240
TPQISTPVPR KQPLQKKKRR PPVSSLVKQR MLQKELQEKR KPSVKRREVE SKRDEIQKQS  300
FREKCELALE RLMNQERLNQ FAMLVDDEEL ELRELRAGPN PLTCTEHFAA NRLFGCSLCK  360
DLLVKFPPNS VKLKQPFAMQ PWDSSPEAVK KLFKVFHFLY TYSVTVDICP FTLDELAQAF  420
HDKDSFLLGK IHVALLKLLL SDVETEISSG LLPHLSISCK FLALLHSVED QEFVVEFWKN  480
SLNPLTWTEI LCQVLIAAGF GSKQGGFRRE VLSKEMSLMV KYGLHPGTLK GELFQLLSVQ  540
GNNGLKVSDL AKSSQIVELN LAGTTDELEL LICSTLSSDI TLFEKISSST FRLRINTLAK  600
EASGFQSDTE DSGIVHEDFH DNGASSSSNS DCDSENSSPR NLKLIDYPKR KNKMLTFENE  660
IDESRPGEVW LLGLMEGEYS DLSIEEKLNG LVALIDLVSA GSSIRLEDLA KPTVESVPNI  720
YHHCSGAKIK RSSSTKDNVP RPSWVHAGQI NVTKEAYTSS KFFPVDSSVL FSKFDGKDKL  780
SGKEKETEGM GLEINLHPMQ SIFLGSDRRY NRYWLFLGPC NSYDPGHKRV YFESSEDGHW  840
EVIDTEEALR ALLSVLDDRG RREALLIESL EKREAFLCQE MSSKMVNDSG VGYFTQSDQS  900
ELETVREDSS SPVSDVDNNL TLTDIANDSL PPMSAIVLET GKKGKEENQK WNRLRQFDTW  960
IWNCFYCDLN AVKRSKRSYL ESLRRCETCH DLYWRDEKHC KICHTTFELD FDLEERYAIH  1020
SATCRQKEDN VMCPKHKVLS SKLQSLKAAV YAIETVMPED ALVGAWTKSA HRLWVRRLRR  1080
TSSLAELLQV VADFVAAINE DWLCQCNLAQ GSSTYMEEII TCFPTMPQTS SALALWLMKL  1140
DELISPYLEK I*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1255259KKKRR
2255260KKKRRP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. May prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing. {ECO:0000250|UniProtKB:F4HY56}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G197800.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2165910.0AC216591.1 Populus trichocarpa clone POP002-D23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440437.10.0homeobox-DDT domain protein RLT3
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLA0A2K1XYM70.0A0A2K1XYM7_POPTR; Uncharacterized protein
STRINGPOPTR_0014s17140.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator