PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G176600.2
Common NamePOPTR_0014s17510g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 199aa    MW: 22442.3 Da    PI: 6.6746
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G176600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR184.12.2e-2642131190
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         +fY eYA++vGF vr+ + ++s  +g++  r++ C+k+g++ +++++    +++r+  r gCka++ vk+ek+gkw+vt++e++HnH+l+
  Potri.014G176600.2  42 RFYTEYARRVGFAVRVMQRRRSGIDGRTLARRLGCNKQGFSPNHRTDVGPDKKPRPGARDGCKATILVKMEKSGKWVVTRFEKDHNHPLV 131
                         5**********************************************9****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-2442131IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MDLDKGVVDT STCCVEEEET VGDGIAEPDV GMEFESEDAA RRFYTEYARR VGFAVRVMQR  60
RRSGIDGRTL ARRLGCNKQG FSPNHRTDVG PDKKPRPGAR DGCKATILVK MEKSGKWVVT  120
RFEKDHNHPL VGGKDKKIEE LTQELEHQEQ LCATYREKLL SFMNNVVEEA EELASKIQVI  180
VDSVRKVESE VQKFSRHG*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G176600.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440394.11e-143protein FAR1-RELATED SEQUENCE 5 isoform X2
SwissprotQ9SZL83e-23FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A2I4KK881e-141A0A2I4KK88_POPTR; FAR1 family protein
STRINGPOPTR_0014s17510.11e-140(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12850.11e-59FAR1 family protein
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]