PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G176600.1
Common NamePOPTR_0014s17510g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 208aa    MW: 23296.2 Da    PI: 6.6746
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G176600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1842.4e-2642131190
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         +fY eYA++vGF vr+ + ++s  +g++  r++ C+k+g++ +++++    +++r+  r gCka++ vk+ek+gkw+vt++e++HnH+l+
  Potri.014G176600.1  42 RFYTEYARRVGFAVRVMQRRRSGIDGRTLARRLGCNKQGFSPNHRTDVGPDKKPRPGARDGCKATILVKMEKSGKWVVTRFEKDHNHPLV 131
                         5**********************************************9****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.1E-2442131IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MDLDKGVVDT STCCVEEEET VGDGIAEPDV GMEFESEDAA RRFYTEYARR VGFAVRVMQR  60
RRSGIDGRTL ARRLGCNKQG FSPNHRTDVG PDKKPRPGAR DGCKATILVK MEKSGKWVVT  120
RFEKDHNHPL VVTTSGFSSS GGKDKKIEEL TQELEHQEQL CATYREKLLS FMNNVVEEAE  180
ELASKIQVIV DSVRKVESEV QKFSRHG*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G176600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440394.11e-153protein FAR1-RELATED SEQUENCE 5 isoform X2
SwissprotQ9SZL83e-23FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A2I4KK881e-151A0A2I4KK88_POPTR; FAR1 family protein
STRINGPOPTR_0014s17510.11e-150(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96531104
Representative plantOGRP3376727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12850.13e-58FAR1 family protein
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]