PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G176500.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 215aa    MW: 24735 Da    PI: 8.4827
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G176500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR197.51.5e-3058146291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fY++YA++vGF +r+++ ++s r+g++++r++vC+keg+r+ + ++ +++r++ra+tr gCka+++vkkek gkw+vt++++eHnH+l+p
  Potri.014G176500.2  58 FYDAYATHVGFIMRVDAFRRSMRDGKVVWRRLVCNKEGFRKLRPRR-SENRKPRAVTREGCKAMIVVKKEKAGKWVVTRFVKEHNHPLVP 146
                         9*******************************************99.9***************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.4E-2958146IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MSQSQMDENA SASMSEDGDM DQIVESSNGK ELAISEASSD MEPCVGMEFE SEEAAKVFYD  60
AYATHVGFIM RVDAFRRSMR DGKVVWRRLV CNKEGFRKLR PRRSENRKPR AVTREGCKAM  120
IVVKKEKAGK WVVTRFVKEH NHPLVPTPAN GRRTDEKDVK IRELTAELQR ERKRSAAYQE  180
QLDMVLRDME EHSNHLSRNI DDIVQSVKEI ESRR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.6290.0bud| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G176500.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024441354.11e-155protein FAR1-RELATED SEQUENCE 2
SwissprotQ9SZL84e-30FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A2K1XXK11e-154A0A2K1XXK1_POPTR; FAR1 family protein
STRINGEMJ016541e-127(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.13e-90FAR1 family protein
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]