PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G176500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 222aa    MW: 25473.9 Da    PI: 8.4827
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G176500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR197.41.6e-3058146291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fY++YA++vGF +r+++ ++s r+g++++r++vC+keg+r+ + ++ +++r++ra+tr gCka+++vkkek gkw+vt++++eHnH+l+p
  Potri.014G176500.1  58 FYDAYATHVGFIMRVDAFRRSMRDGKVVWRRLVCNKEGFRKLRPRR-SENRKPRAVTREGCKAMIVVKKEKAGKWVVTRFVKEHNHPLVP 146
                         9*******************************************99.9***************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.0E-2958146IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MSQSQMDENA SASMSEDGDM DQIVESSNGK ELAISEASSD MEPCVGMEFE SEEAAKVFYD  60
AYATHVGFIM RVDAFRRSMR DGKVVWRRLV CNKEGFRKLR PRRSENRKPR AVTREGCKAM  120
IVVKKEKAGK WVVTRFVKEH NHPLVPTPAN GRRTVLLSQT PDEKDVKIRE LTAELQRERK  180
RSAAYQEQLD MVLRDMEEHS NHLSRNIDDI VQSVKEIESR R*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.6290.0bud| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G176500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024441354.11e-164protein FAR1-RELATED SEQUENCE 2
TrEMBLA0A2K1XXK11e-162A0A2K1XXK1_POPTR; FAR1 family protein
STRINGEMJ016541e-136(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96531104
Representative plantOGRP3376727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.18e-96FAR1 family protein