PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G170600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CO-like
Protein Properties Length: 417aa    MW: 45232.2 Da    PI: 4.78
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G170600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.61.9e-06444539
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                        +C+ ++e++   +C+++   lC +C  + H+       H++
  Potri.014G170600.1  4 VCDFCGEQRSMVYCRSDAASLCLSCDRNVHSAnalskrHSR 44
                        6*****************************65677777765 PP

2zf-B_box21.84e-074689441
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvp 41
                          C++++++++   C + +  lC++C   +H g       H++++
  Potri.014G170600.1 46 LLCERCNSQPALVRCAEERISLCQNCDWIGH-GtstsastHRRQT 89
                        57**************************99*.5477888887765 PP

3CCT639e-22359402144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R  a++RYkeK+ktR FeKk+rY+sRKa+A+ R RvKGrFvk+ 
  Potri.014G170600.1 359 RSDAVMRYKEKKKTRMFEKKVRYASRKARADVRRRVKGRFVKAG 402
                         889**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.812147IPR000315B-box-type zinc finger
SMARTSM003361.1E-8447IPR000315B-box-type zinc finger
CDDcd000212.23E-7447No hitNo description
PROSITE profilePS501198.8594390IPR000315B-box-type zinc finger
CDDcd000212.53E-54790No hitNo description
SMARTSM003363.44890IPR000315B-box-type zinc finger
PfamPF062034.7E-17359401IPR010402CCT domain
PROSITE profilePS5101715.229359401IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MGYVCDFCGE QRSMVYCRSD AASLCLSCDR NVHSANALSK RHSRTLLCER CNSQPALVRC  60
AEERISLCQN CDWIGHGTST SASTHRRQTI NSYSGCPSAS ELSSIWSFVL DFPSRGESTC  120
EQELGLMSIA ENSTTDSWGP TENTIGQNAS GVVEVNDRRE IAKSGVWLGS SSIPESSSVP  180
NNLDQTTRSA NTSLPKLCCP GTKCPAPYED ADLYEDFNMD EMDLSLENYE ELFGVTLNNS  240
EELLENGGID SLFGTKDMSG ADSSCQGAVA AEGSSVGVVN AVQPASSNAA SADSMMSNKT  300
EPILCFTEKQ GHSSLSFSGL NVESSAADYQ DCGASSMLLM GEPPWCPPCP ESPFSSANRS  360
DAVMRYKEKK KTRMFEKKVR YASRKARADV RRRVKGRFVK AGEAYDYDPL SQTRSF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G170600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2149950.0AC214995.1 Populus trichocarpa clone POP004-B08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024441090.10.0zinc finger protein CONSTANS-LIKE 9
SwissprotQ9SSE51e-153COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A2K1XX940.0A0A2K1XX94_POPTR; Uncharacterized protein
STRINGPOPTR_0014s16870.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43623353
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-111CONSTANS-like 9