PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G164400.1
Common NamePOPTR_0014s16230g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 548aa    MW: 60759.8 Da    PI: 6.1613
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G164400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS454.18.7e-1391775471374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+++L++cA+avs++dl +aq l+ +l++++s +g+p+qRl ay++e+L arla+s+s+++k l+++e +   s+e l+++++++ev+ ++
  Potri.014G164400.1 177 LKQVLIACAKAVSDNDLLMAQCLMDKLRQMVSVSGEPIQRLGAYMLEGLVARLASSGSSICKGLRCKEPA---SAEMLSYMHILYEVCAYF 264
                         5799*****************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf+++ aN aI ea++ e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg+++++s   +   l+ +g+rL+k+Ae+++vpfef++
  Potri.014G164400.1 265 KFGYMSANGAIAEAMKDENRVHIIDFQIGQGSQWISLIQAFAARPGGPPHIRITGIDDSTSAyaRGGGLSIVGKRLSKLAESFKVPFEFHA 355
                         **********************************************************998899999************************ PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +a +  ++++e+L v++gEalaVn+++ lh+++desvs++++rd+vL+lvks+sPkvv++veqe+++n++ F+ rf+e+l+yy+a+f+s+
  Potri.014G164400.1 356 -AAMSGCEVQIENLGVRRGEALAVNFAFVLHHMPDESVSTQNHRDRVLRLVKSMSPKVVTLVEQESNTNTAAFFPRFIETLNYYTAMFESI 445
                         .89999************************************************************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +++lpr+++eri+vE+++l+r++vn++aceg+er+erhe l+kWr+r+++aGF+p+pls+ +++++k+ll++++++ yr++e++g+l+lgW
  Potri.014G164400.1 446 DVTLPRDHKERINVEQHCLARDVVNIIACEGTERVERHELLGKWRSRFTMAGFTPYPLSTLVNATIKTLLENYSDR-YRLQERDGALYLGW 535
                         **************************************************************************66.************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         ++r Lv+ +aW+
  Potri.014G164400.1 536 MNRDLVASCAWK 547
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.36151528IPR005202Transcription factor GRAS
PfamPF035143.0E-136177547IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007165Biological Processsignal transduction
GO:0009640Biological Processphotomorphogenesis
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004871Molecular Functionsignal transducer activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MQASKQLRGS GMSSRFLYQP MQEVEAYCKP QSRTLDRQIY SSGSTQGTPF TIPNSHEQYC  60
TLESSSANGS YAAYNSPSTV SFSPNGSPLS QQESQSYSLE PRHSPDNASG SPLSGSCITD  120
DAHDFSHKLR ELETVMFGPD SDIIDSIENA LESGTNIESL EMDSWRQIMD VISRGDLKQV  180
LIACAKAVSD NDLLMAQCLM DKLRQMVSVS GEPIQRLGAY MLEGLVARLA SSGSSICKGL  240
RCKEPASAEM LSYMHILYEV CAYFKFGYMS ANGAIAEAMK DENRVHIIDF QIGQGSQWIS  300
LIQAFAARPG GPPHIRITGI DDSTSAYARG GGLSIVGKRL SKLAESFKVP FEFHAAAMSG  360
CEVQIENLGV RRGEALAVNF AFVLHHMPDE SVSTQNHRDR VLRLVKSMSP KVVTLVEQES  420
NTNTAAFFPR FIETLNYYTA MFESIDVTLP RDHKERINVE QHCLARDVVN IIACEGTERV  480
ERHELLGKWR SRFTMAGFTP YPLSTLVNAT IKTLLENYSD RYRLQERDGA LYLGWMNRDL  540
VASCAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-601795476375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321179.10.0hypothetical protein POPTR_0014s16230g
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLB9IAQ70.0B9IAQ7_POPTR; Uncharacterized protein
STRINGPOPTR_0014s16230.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14091447
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein