PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G152000.4
Common NamePOPTR_0014s15010g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 727aa    MW: 79749.4 Da    PI: 5.5358
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G152000.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-2059114156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Potri.014G152000.4  59 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 114
                         688999***********************************************999 PP

2START218.42.4e-682484681206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela +a++elv++a+ +ep+W+ s       +++de++++f+++ +     ++ ea+r+s+vv+m++ +lve l+d++ qW++ +     +
  Potri.014G152000.4 248 ELAVAAMEELVRMAQMDEPLWMGSLdgtnAVLDEDEYVRIFPRGIGpkptgFKCEASRESAVVIMNHINLVEYLMDVN-QWSTLFSgivsR 337
                         57899********************99888899**********999********************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a tlev+s+g      galq+m+ae+q+++plvp R+++fvRy++q+ +g+w++vdvS+d+ ++ p    ++R++++pSg+li+++ ng+s
  Potri.014G152000.4 338 ALTLEVLSTGvagnynGALQVMTAEFQLPTPLVPtRESYFVRYCKQHADGTWAVVDVSLDNLRPSP----GARCRRRPSGCLIQEMLNGYS 424
                         ****************************************************************99....6******************** PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kvtwvehv++++r +h+l+++lv+sg+a+gak+wvatl+rqce+
  Potri.014G152000.4 425 KVTWVEHVEVDDRGVHNLYKQLVSSGHAFGAKRWVATLDRQCER 468
                         ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-2238114IPR009057Homeodomain-like
SuperFamilySSF466891.09E-1946116IPR009057Homeodomain-like
PROSITE profilePS5007116.95756116IPR001356Homeobox domain
SMARTSM003894.8E-2057120IPR001356Homeobox domain
PfamPF000464.1E-1859114IPR001356Homeobox domain
CDDcd000862.46E-1959117No hitNo description
PROSITE patternPS00027091114IPR017970Homeobox, conserved site
SuperFamilySSF559611.74E-34239470No hitNo description
PROSITE profilePS5084843.814239471IPR002913START domain
CDDcd088752.48E-129243467No hitNo description
SMARTSM002344.7E-66248468IPR002913START domain
PfamPF018529.0E-58249468IPR002913START domain
Gene3DG3DSA:3.30.530.209.4E-5344449IPR023393START-like domain
SuperFamilySSF559611.99E-23487718No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010090Biological Processtrichome morphogenesis
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MFQPNMMEGQ LHRLDMTQNT PEGDMARIRD DEFDSTNTKS GSENQDGASG DDQDPRPKKK  60
RYHRHTQHQI QEMEAFFKEC PHPDDKQRKE LSRELGLEPL QVKFWFQNKR TQMKTQHERH  120
ENTQLRNENE KLRADNMRYR EALSNASCPN CGGPTAIGEM SFDEHHLRLE NARLREEIDR  180
ISAIAAKYVG KPVVNYPLIS APMPPRPLDL GVGNFGGQPG IGGEIYGAGD LLRSITAPTE  240
ADKPMIIELA VAAMEELVRM AQMDEPLWMG SLDGTNAVLD EDEYVRIFPR GIGPKPTGFK  300
CEASRESAVV IMNHINLVEY LMDVNQWSTL FSGIVSRALT LEVLSTGVAG NYNGALQVMT  360
AEFQLPTPLV PTRESYFVRY CKQHADGTWA VVDVSLDNLR PSPGARCRRR PSGCLIQEML  420
NGYSKVTWVE HVEVDDRGVH NLYKQLVSSG HAFGAKRWVA TLDRQCERLA SAMATNIPAG  480
DVGVITNQEG RKSMMKLAER MVISFCAGVS ASTAHTWTTL SGTGADDVRV MTRKSVDDPG  540
RPPGIVLSAA TSFWLPVPPK RVFDFLRDES TRNEWDILSN GGVVQEMAHI ANGRDTGNCV  600
SLLRVNSANS SQSNMLILQE SCADQTASFV IYAPVDIVAM NVVLNGGDPD YVALLPSGFA  660
VLPDGTGAHV GGMEEAAGGS LLTVAFQILV DSVPTAKLSL GSVATVNNLI ACTVERIKAS  720
LSCESA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.35720.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hairless cell files of the hypocotyl epidermis. Expressed in shoot apical meristem (SAM) with higher levels in L1 cells and the epidermal layer of young leaves. Expressed in primary root tips, in the L1 of apical inflorescence meristems, early flower primordia, carpel epidermis, ovule primordia, nucellus, chalaze and seed coat. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G152000.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440389.10.0homeobox-leucine zipper protein HDG2 isoform X1
RefseqXP_024440390.10.0homeobox-leucine zipper protein HDG2 isoform X1
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLA0A2K1XW690.0A0A2K1XW69_POPTR; Uncharacterized protein
STRINGPOPTR_0014s15010.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2