PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G152000.1
Common NamePOPTR_0014s15010g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 763aa    MW: 83224.4 Da    PI: 5.6446
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G152000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2095150156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Potri.014G152000.1  95 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 150
                         688999***********************************************999 PP

2START218.22.7e-682845041206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela +a++elv++a+ +ep+W+ s       +++de++++f+++ +     ++ ea+r+s+vv+m++ +lve l+d++ qW++ +     +
  Potri.014G152000.1 284 ELAVAAMEELVRMAQMDEPLWMGSLdgtnAVLDEDEYVRIFPRGIGpkptgFKCEASRESAVVIMNHINLVEYLMDVN-QWSTLFSgivsR 373
                         57899********************99888899**********999********************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a tlev+s+g      galq+m+ae+q+++plvp R+++fvRy++q+ +g+w++vdvS+d+ ++ p    ++R++++pSg+li+++ ng+s
  Potri.014G152000.1 374 ALTLEVLSTGvagnynGALQVMTAEFQLPTPLVPtRESYFVRYCKQHADGTWAVVDVSLDNLRPSP----GARCRRRPSGCLIQEMLNGYS 460
                         ****************************************************************99....6******************** PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kvtwvehv++++r +h+l+++lv+sg+a+gak+wvatl+rqce+
  Potri.014G152000.1 461 KVTWVEHVEVDDRGVHNLYKQLVSSGHAFGAKRWVATLDRQCER 504
                         ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-2274150IPR009057Homeodomain-like
SuperFamilySSF466891.17E-1982152IPR009057Homeodomain-like
PROSITE profilePS5007116.95792152IPR001356Homeobox domain
SMARTSM003894.8E-2093156IPR001356Homeobox domain
PfamPF000464.3E-1895150IPR001356Homeobox domain
CDDcd000862.71E-1995153No hitNo description
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
SuperFamilySSF559612.31E-34275506No hitNo description
PROSITE profilePS5084843.814275507IPR002913START domain
CDDcd088751.06E-128279503No hitNo description
SMARTSM002344.7E-66284504IPR002913START domain
PfamPF018529.9E-58285504IPR002913START domain
Gene3DG3DSA:3.30.530.201.1E-4380485IPR023393START-like domain
SuperFamilySSF559612.43E-23523754No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010090Biological Processtrichome morphogenesis
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    Send to blast
MPAGMMIPAR NMPSMIGVNG NAGGFGSSSG LALGQIMFQP NMMEGQLHRL DMTQNTPEGD  60
MARIRDDEFD STNTKSGSEN QDGASGDDQD PRPKKKRYHR HTQHQIQEME AFFKECPHPD  120
DKQRKELSRE LGLEPLQVKF WFQNKRTQMK TQHERHENTQ LRNENEKLRA DNMRYREALS  180
NASCPNCGGP TAIGEMSFDE HHLRLENARL REEIDRISAI AAKYVGKPVV NYPLISAPMP  240
PRPLDLGVGN FGGQPGIGGE IYGAGDLLRS ITAPTEADKP MIIELAVAAM EELVRMAQMD  300
EPLWMGSLDG TNAVLDEDEY VRIFPRGIGP KPTGFKCEAS RESAVVIMNH INLVEYLMDV  360
NQWSTLFSGI VSRALTLEVL STGVAGNYNG ALQVMTAEFQ LPTPLVPTRE SYFVRYCKQH  420
ADGTWAVVDV SLDNLRPSPG ARCRRRPSGC LIQEMLNGYS KVTWVEHVEV DDRGVHNLYK  480
QLVSSGHAFG AKRWVATLDR QCERLASAMA TNIPAGDVGV ITNQEGRKSM MKLAERMVIS  540
FCAGVSASTA HTWTTLSGTG ADDVRVMTRK SVDDPGRPPG IVLSAATSFW LPVPPKRVFD  600
FLRDESTRNE WDILSNGGVV QEMAHIANGR DTGNCVSLLR VNSANSSQSN MLILQESCAD  660
QTASFVIYAP VDIVAMNVVL NGGDPDYVAL LPSGFAVLPD GTGAHVGGME EAAGGSLLTV  720
AFQILVDSVP TAKLSLGSVA TVNNLIACTV ERIKASLSCE SA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.35720.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hairless cell files of the hypocotyl epidermis. Expressed in shoot apical meristem (SAM) with higher levels in L1 cells and the epidermal layer of young leaves. Expressed in primary root tips, in the L1 of apical inflorescence meristems, early flower primordia, carpel epidermis, ovule primordia, nucellus, chalaze and seed coat. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G152000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440389.10.0homeobox-leucine zipper protein HDG2 isoform X1
RefseqXP_024440390.10.0homeobox-leucine zipper protein HDG2 isoform X1
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLB9IAE60.0B9IAE6_POPTR; Uncharacterized protein
STRINGPOPTR_0014s15010.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2