PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G135300.1
Common NamePOPTR_0014s12980g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 687aa    MW: 76847.1 Da    PI: 7.8545
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G135300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.81.2e-24151252199
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f k+ltpsd+ ++g +++pk++a+++       +  ++  ++l  +d++g +W +k+iyr++++r+++t+GW+ Fv++++L +gD+++F  
  Potri.014G135300.1 151 FTKKLTPSDTKTHGGFSVPKRHADQClppldksQ--QPPVQELLAKDLHGFEWCFKHIYRGQPKRHLITSGWSTFVSSKRLVAGDSFIFL- 238
                         89****************************9643..344458************************************************. PP

                         -SSSEE..EEEEE-S CS
                  B3  85 dgrsefelvvkvfrk 99 
                          + +++el+v+v+r+
  Potri.014G135300.1 239 -RGESGELRVGVRRA 252
                         .449999*****996 PP

2Auxin_resp105.37.2e-35277359183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++t+s+F+++++P++s++eF++++++++k+ ++ +s+G+Rf+m fe+e+++e+r+ Gtvvg++d+d +rWpnS+Wr Lk
  Potri.014G135300.1 277 ASHAITTGSMFTIYFHPWTSPAEFIIPYDQYMKSAEIDYSAGTRFRMLFEGEECAEQRFEGTVVGTEDVDHIRWPNSEWRILK 359
                         789*****************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.5E-38146263IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.67E-34147277IPR015300DNA-binding pseudobarrel domain
CDDcd100174.00E-21149251No hitNo description
PROSITE profilePS5086312.421151253IPR003340B3 DNA binding domain
PfamPF023622.5E-22151252IPR003340B3 DNA binding domain
SMARTSM010195.4E-22151253IPR003340B3 DNA binding domain
PfamPF065073.9E-32277359IPR010525Auxin response factor
PfamPF023099.8E-7574666IPR033389AUX/IAA domain
PROSITE profilePS5174514.923587671IPR000270PB1 domain
SuperFamilySSF542775.3E-5591664No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MGKKRSVAGE AKTSRSHEVG VLKTTKCFNN GLPPRNPQEN KDDLYTELWH ACAGPLVYVP  60
RAGDKVFYFP QGHMEQVAAR MNEEGKMEMP IYDLPYKILC KVVHVELKAE AGTDEVFARI  120
TLLPVAEEDE LSSNKDGKSL PLHRKTCARS FTKKLTPSDT KTHGGFSVPK RHADQCLPPL  180
DKSQQPPVQE LLAKDLHGFE WCFKHIYRGQ PKRHLITSGW STFVSSKRLV AGDSFIFLRG  240
ESGELRVGVR RAMKLENNLS ANILSSHSMQ LGILSSASHA ITTGSMFTIY FHPWTSPAEF  300
IIPYDQYMKS AEIDYSAGTR FRMLFEGEEC AEQRFEGTVV GTEDVDHIRW PNSEWRILKV  360
KWDAASEPFV HQERVSPWNI EPIEPIRKKH ASRLHLHKME CIADKSLPRF LISVKEVPHL  420
TSPPNPDWNR SPIGRDNQLQ FWMGGPIYPC PSNTVSFPGG NIARLGIPNS RHSTFNSYGV  480
HDNAVGSRSL SVPNVSHNSG SQKWRGSELK HANEVPLAAP HRYMLFGVNL VSNSPELPSS  540
QVATSVVNES HNYVPVTSQS SVSEPSKSTS GVNSEKQCKN CCSAAIRSCT KVLKYGTVPG  600
RSVDLTQFDG YNELICELDL MFDFQGSLID ETSGWYVVYS DNEGDMMQIK DCPWQEFQLT  660
VRRIFISPKE DIGKLNPLSP NPSPSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1374238317355Auxin response factor 1
4ldw_A1e-1374238317355Auxin response factor 1
4ldw_B1e-1374238317355Auxin response factor 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G135300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2091901e-152AC209190.1 Populus trichocarpa clone POP078-N23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440769.10.0auxin response factor 2B
TrEMBLA0A2K1XV500.0A0A2K1XV50_POPTR; Auxin response factor
STRINGPOPTR_0014s12980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131052329
Representative plantOGRP1325645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.21e-163auxin response factor 1