PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G132800.2
Common NamePOPTR_0014s12730g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 1119aa    MW: 122888 Da    PI: 8.5181
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G132800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox14.85e-0565121157
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         +r+R  ++++ ++ ++e+F  +   s++e ++++ + g t +qV+ +F  +R++ +k
  Potri.014G132800.2  65 KRPRDLINPKAVKYMQEVFTIKDAFSKKESRDISVQFGATVTQVRDFFASQRTRVRK 121
                         799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.16762122IPR001356Homeobox domain
SuperFamilySSF466893.29E-564125IPR009057Homeodomain-like
SMARTSM003890.001364126IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.8E-565130IPR009057Homeodomain-like
CDDcd000860.0044465121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1119 aa     Download sequence    Send to blast
MEDLTETEIG SSVESFQKFL DSQREVFHNQ IDHLRRIVVT QCKLTGVNPL SQEMAPGALS  60
IKIGKRPRDL INPKAVKYMQ EVFTIKDAFS KKESRDISVQ FGATVTQVRD FFASQRTRVR  120
KLIRLSMEKA IRVNAHKEPQ NGVLTTSDAL MPIDLVPLNS VDPNQVPLNY VCSNPAMLNS  180
VSPNPIHLNS AGSISAPLNS VSSISAPLNS VSPNPFHLES VSSNPVPLIS VSPNPVPLNH  240
ASLYPVPLDS VARNPVPLNS AGPSRVDEAP SCSTQDDMLP GLDELDKHFV ENIFGLLRKE  300
ETFTGQVKLM EWILQIHTLS VLNWFLFNGG VMILVTWLSQ AAAEEQTSVL IVTLNVFCHL  360
PLHKAPPEHM SAILRGVNRL RFYRTSDISN RARVLLSRWS KVFARSQAMK KPYGVNFSTD  420
AQDMILKQSI DEIMGNELWQ SDISNPDGVP ALSLESSENI RKIESSQALK LLPASTDDPS  480
RKHILGAPSS HTRERRKVQL VEQPGQKTAG RSPQATKAAP VSTGRPMSAD DIQKAKMRAL  540
FMQNKHGKTG LSSNGNTGMK NGPSSMSASL SLVSKIHIRP KIEEYKKPVM PPLEVSCKVE  600
GSLNPKKEID SKEAMWGVCI EVKIPWKTPP EIKLNVLWRV GTGENGKEVD VQKNRNRREV  660
ETIYQTVQEL PSNPKEPWDL EMDYDDTLTP EIPIEQPPDA DGAEIQVSLT EHVNTVVAPS  720
PAPSLPQVGG GSATEPDLEL LAVLLKNPEL VFALTSGQAG NLSSEETVKL LDMIKAGGAG  780
LAGSLNGLVG KVGEKVEVSL PSPTPSSNPG TSGWRSEGDK NPFSQQASSG NRVAYTDPGV  840
PTVAPLAENT SSVQRQNQAT NIRTPQQQAS RPILSQHHPF SLSQTSIIVP ENRQPPMVLQ  900
SQQSYPTNSS MLHTPSSEIV FTMKNLPVNT PSLPNPSAAI GPSMWVETMN NVKPAPSISL  960
TSNPPERWPV PFPRSTSAVP APTQLQSHIN EPPTVHSSWP HTGDVGPMRD SWRVRQSLVS  1020
NSPSHVNQNN YVPPYGGPVQ PQLRSGPPRE RNEYLGDEGI ESWSPENSRF ESQEYMSGRN  1080
YSGARTNSGW DYLPDNRSRQ RNSSGYRDRN RNGNRRRH*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates prior to flowering in the vegetative shoot apical meristem and after flowering in floral meristems.
UniprotTISSUE SPECIFICITY: Expressed in shoot apex, root apex, leaf primordia and floral buds.
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G132800.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440704.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-170LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A2K1XUY10.0A0A2K1XUY1_POPTR; Uncharacterized protein
STRINGPOPTR_0014s12730.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-105HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]