PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G132800.1
Common NamePOPTR_0014s12730g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 1137aa    MW: 124915 Da    PI: 8.7718
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G132800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox14.85.1e-0557113157
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         +r+R  ++++ ++ ++e+F  +   s++e ++++ + g t +qV+ +F  +R++ +k
  Potri.014G132800.1  57 KRPRDLINPKAVKYMQEVFTIKDAFSKKESRDISVQFGATVTQVRDFFASQRTRVRK 113
                         799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.16754114IPR001356Homeobox domain
SMARTSM003890.001356118IPR001356Homeobox domain
SuperFamilySSF466893.38E-556117IPR009057Homeodomain-like
CDDcd000860.0045257113No hitNo description
Gene3DG3DSA:1.10.10.606.0E-557122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1137 aa     Download sequence    Send to blast
MEDLTETEIG SSVESFQKFL DSQREVFHNQ IDHLRRIVVT QCKLTGAAGA LSIKIGKRPR  60
DLINPKAVKY MQEVFTIKDA FSKKESRDIS VQFGATVTQV RDFFASQRTR VRKLIRLSME  120
KAIRVNAHKE PQNGVLTTSD ALMPIDLVPL NSVDPNQVPL NYVCSNPAML NSVSPNPIHL  180
NSAGSISAPL NSVSSISAPL NSVSPNPFHL ESVSSNPVPL ISVSPNPVPL NHASLYPVPL  240
DSVARNPVPL NSAGPSRVDE APSCSTQDDM LPGLDELDKH FVENIFGLLR KEETFTGQVK  300
LMEWILQIHT LSVLNWFLFN GGVMILVTWL SQAAAEEQTS VLIVTLNVFC HLPLHKAPPE  360
HMSAILRGVN RLRFYRTSDI SNRARVLLSR WSKVFARSQA MKKPYGVNFS TDAQDMILKQ  420
RQVHEITSYN LKICSIKSHL LALISCSIDE IMGNELWQSD ISNPDGVPAL SLESSENIRK  480
IESSQALKLL PASTDDPSRK HILGAPSSHT RERRKVQLVE QPGQKTAGRS PQATKAAPVS  540
TGRPMSADDI QKAKMRALFM QNKHGKTGLS SNGNTGMKNG PSSMSASLSL VSKIHIRPKI  600
EEYKKPVMPP LEVSCKVEGS LNPKKEIDSK EAMWGVCIEV KIPWKTPPEI KLNVLWRVGT  660
GENGKEVDVQ KNRNRREVET IYQTVQELPS NPKEPWDLEM DYDDTLTPEI PIEQPPDADG  720
AEIQVSLTEH VNTVVAPSPA PSLPQVGGGS ATEPDLELLA VLLKNPELVF ALTSGQAGNL  780
SSEETVKLLD MIKAGGAGLA GSLNGLVGKV GEKVEVSLPS PTPSSNPGTS GWRSEGDKNP  840
FSQQASSGNR VAYTDPGVPT VAPLAENTSS VQRQNQATNI RTPQQQASRP ILSQHHPFSL  900
SQTSIIVPEN RQPPMVLQSQ QSYPTNSSML HTPSSEIVFT MKNLPVNTPS LPNPSAAIGP  960
SMWVETMNNV KPAPSISLTS NPPERWPVPF PRSTSAVPAP TQLQSHINEP PTVHSSWPHT  1020
GDVGPMRDSW RVRQSLVSNS PSHVNQNNYV PPYGGPVQPQ LRSGPPRERN EYLGDEGIES  1080
WSPENSRFES QEYMSGRNYS GARTNSGWDY LPDNRSRQRN SSGYRDRNRN GNRRRH*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates prior to flowering in the vegetative shoot apical meristem and after flowering in floral meristems.
UniprotTISSUE SPECIFICITY: Expressed in shoot apex, root apex, leaf primordia and floral buds.
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G132800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440704.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-165LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A2K1XV190.0A0A2K1XV19_POPTR; Uncharacterized protein
STRINGPOPTR_0014s12730.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Representative plantOGRP41211315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-99HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]