PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G120000.1
Common NamePOPTR_0014s11510g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 577aa    MW: 65649.8 Da    PI: 7.0616
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G120000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS254.83.3e-782155661374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.......sseelaalklf 84 
                         l++lLl++Ae v  +++ +a++lL+r +  as++ +p+qR++ +f+eAL+ r+ +        +pp+e + k         s++la +   
  Potri.014G120000.1 215 LTHLLLAAAEKVGYRQFDRASRLLSRGERVASERSNPLQRVVYHFAEALRWRIDK----ATGRFPPTEMKGKPkcvtphgLSTHLA-HLSV 300
                         579***************************************************9....333333433333323423331333333.3337 PP

                GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvp 175
                         ++  Pi ++ +lta qaI e v +++++H iD++i  G+QW aL+qaLa+R++   +l+iT+vg       +++eetg+rL+ fA+++++p
  Potri.014G120000.1 301 HQKVPINQVMQLTAIQAINENVGSARKIHLIDLEIRSGVQWTALMQALADRQRRLDHLKITAVGL---RGIQKIEETGKRLETFAKSMNLP 388
                         8889************************************************************9...5799******************* PP

                GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                         f f+++ ++++++++ e +++  +E+++V + + l ++l+++++le+    +++++k+l+P +++v e ea+hns++F++rf+eal +y a
  Potri.014G120000.1 389 FTFKPIQVSSMSEIKEELFETAADETVVVVSNMILRTMLSRPACLEN----LMEVIKNLNPSLMIVGEVEANHNSPKFVNRFIEALFFYGA 475
                         *********************************************99....**************************************** PP

                GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesg 356
                          fds+ ++                   i+n+va+eg++r++r+ +   Wr+ ++++ + +v +se+   qa+l+ ++++ +d  ++e++ +
  Potri.014G120000.1 476 YFDSIFSN------------------GIENMVAMEGTDRIARNVKIDVWRAFFSRFRMVEVGFSESSLYQASLIPKQFPyGDSCTLEKNGK 548
                         ****8555..................69999************************************************9*********** PP

                GRAS 357 slvlgWkdrpLvsvSaWr 374
                         +l++gW++ pL s+SaW+
  Potri.014G120000.1 549 CLIIGWEGTPLHSLSAWK 566
                         *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.359189545IPR005202Transcription factor GRAS
PfamPF035141.1E-75215566IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MANASFSFDP FDFNGIQSGY SHNEDYEKEE LVIKGKQDRM FSMEDLGQVY PICSEYGAYQ  60
DNTENKELNF FRDQHQQQPQ QQQSPPNTNY LALDDLLGYC FPAPAQPTQE IRKIENIVEH  120
SKEMQYTPAL SSSLQLLHNY GSGIKKLNAN QPGSASNETC FGSRKKLSTE EIIRVAGSMF  180
IQFSDQRYDD FSMLMHPFGY ALSGLSEEEK RDVELTHLLL AAAEKVGYRQ FDRASRLLSR  240
GERVASERSN PLQRVVYHFA EALRWRIDKA TGRFPPTEMK GKPKCVTPHG LSTHLAHLSV  300
HQKVPINQVM QLTAIQAINE NVGSARKIHL IDLEIRSGVQ WTALMQALAD RQRRLDHLKI  360
TAVGLRGIQK IEETGKRLET FAKSMNLPFT FKPIQVSSMS EIKEELFETA ADETVVVVSN  420
MILRTMLSRP ACLENLMEVI KNLNPSLMIV GEVEANHNSP KFVNRFIEAL FFYGAYFDSI  480
FSNGIENMVA MEGTDRIARN VKIDVWRAFF SRFRMVEVGF SESSLYQASL IPKQFPYGDS  540
CTLEKNGKCL IIGWEGTPLH SLSAWKFSRE RLWRSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3024456632375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320295.20.0hypothetical protein POPTR_0014s11510g
TrEMBLB9I9I40.0B9I9I4_POPTR; Uncharacterized protein
STRINGPOPTR_0014s11510.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.13e-56RGA-like 2