PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G106800.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 735aa    MW: 80295.9 Da    PI: 6.4498
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G106800.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-152468147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r rWT+eE+ ++++a k++G   W +I +++g ++t  q++s+ qk+
  Potri.014G106800.4 24 RERWTEEEHSRFLEALKLYGRA-WQRIEEHIG-TKTVVQIRSHAQKF 68
                        78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-161874IPR009057Homeodomain-like
PROSITE profilePS5129419.2641973IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-72170IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-162271IPR006447Myb domain, plants
SMARTSM007172.1E-122371IPR001005SANT/Myb domain
PfamPF002491.6E-122467IPR001005SANT/Myb domain
CDDcd001674.78E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MEIFSSGEDL VIKTRKPYTI TKQRERWTEE EHSRFLEALK LYGRAWQRIE EHIGTKTVVQ  60
IRSHAQKFFS KLEKEAVVKG VPIGQALDID IPPPRPKRKP SNPYPRKIGV GPPASQKLNG  120
DERPTNAKEN QDDNCSEVFS LLQEPHCSSV PSINKNSVPT LDILKKASPF REFVSSPKEG  180
NHDASNQSSV TVELGANQKL DNSDVKQDNS TSEFSKSENF CSFSEKLFQQ KKSDDFIGAL  240
RTDGMQAMQN YPRHVPVHVL DGSLGTCMQT PPSDFSFQES MFHPIGEIPA CPNLYSHPAA  300
SKTTDHPNIS PRSSMHQSFP SFPPPFTPTH HNQDDYRSFL HISSTFSSLV VSSLLQNPAA  360
HAAASFASTF WPYGNVESSA DSPACAQGGF QSRQLNSAPS MAAIVAATVA AATAWWTAHG  420
LLPMCAPLHT SFACPPASAT AIQSVDTGQV SATKTERKET AENPSLQGQI QGPEHTEALQ  480
AQNSASKSPK ITSSDSEESG GPKLNTGPEV IDHELTTKPH EVQDSSKTKS RKLIDRSSCG  540
SNTPSSSEIE TDALEKAEKG TEEPKEDDAN HPASESSSRH SRSSSSMNDS WKEVSEEGRL  600
AFQALFAREV LPQSFSPPHD LKSKMHQNED AGEKKDADEK DGDASLINLN SKTWECCSGH  660
QEGEKNALSR CENYGEEELL TIGLGHGKLK VRRTGFKPYK RCSLEAKESR TGTGSGQGEE  720
KGPKRLRLEG EASV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.126230.0bud| catkin| leaf| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G106800.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1480670.0EF148067.1 Populus trichocarpa clone WS0127_E23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024441064.10.0protein LHY isoform X1
RefseqXP_024441065.10.0protein LHY isoform X1
RefseqXP_024441066.10.0protein LHY isoform X1
TrEMBLA9PI510.0A9PI51_POPTR; Uncharacterized protein
STRINGPOPTR_0014s10260.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-118MYB_related family protein
Publications ? help Back to Top
  1. Ralph SG, et al.
    Analysis of 4,664 high-quality sequence-finished poplar full-length cDNA clones and their utility for the discovery of genes responding to insect feeding.
    BMC Genomics, 2008. 9: p. 57
    [PMID:18230180]