PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G100800.2
Common NamePOPTR_0014s09630g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 214aa    MW: 24260.3 Da    PI: 9.6121
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G100800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.6e-171055148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+ T++Ed+l+++ + +lG++ W++Ia +++ gRt++++k++w+++l
  Potri.014G100800.2 10 RGNITPDEDDLIIRMHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 55
                        7999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.38E-15163IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-25159IPR009057Homeodomain-like
PROSITE profilePS5129425.663559IPR017930Myb domain
SMARTSM007171.3E-15957IPR001005SANT/Myb domain
PfamPF002493.5E-151055IPR001005SANT/Myb domain
CDDcd001673.04E-131455No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MNYLRPDIKR GNITPDEDDL IIRMHSLLGN RWSLIAGRLP GRTDNEIKNY WNTHLVKRLR  60
SQGITDPGTH RKLAEPGERE VKRRRSNKNT SNKKQNKSKA KLILPAEKHK VHLPKPVRFT  120
SLPLPRNDSF ESNTITISPS QGRDQGSFGT GDSFLVGDND RYGLVNGSDL ECQSPVPTTN  180
TLEKLYEEYL QLLEIDDRQD QVLLDSFADS LLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-1425951108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G100800.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320876.11e-154myb-related protein 308
TrEMBLB9I9001e-153B9I900_POPTR; Uncharacterized protein
STRINGPOPTR_0014s09630.11e-154(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.13e-35myb domain protein 7