PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G100100.2
Common NamePOPTR_0014s09560g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 532aa    MW: 59181.6 Da    PI: 8.5501
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G100100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.45.4e-188703498
                        SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                  B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                        ++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +++el+v+++r
  Potri.014G100100.2  8 QELAARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--RGDNGELRVGLRR 70
                        58999*********************************************..3489999***998 PP

2Auxin_resp93.24.4e-3196175183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha+ t++ F v+Y+Pr+   ++++ ++k+++a+k+ +svGmRfkm+fe+ed +err++Gt+vgv d++p +W++S WrsLk
  Potri.014G100100.2  96 ASHAVLTHTLFVVYYKPRT--NQYIIGLNKYLEAVKNGFSVGMRFKMRFEGEDTPERRFTGTIVGVGDISP-EWSGSIWRSLK 175
                         689999************6..99**********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010193.3E-4172IPR003340B3 DNA binding domain
PROSITE profilePS5086312.633172IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-24285IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-22299IPR015300DNA-binding pseudobarrel domain
PfamPF023626.9E-16770IPR003340B3 DNA binding domain
CDDcd100173.26E-13870No hitNo description
PfamPF065072.9E-2996175IPR010525Auxin response factor
PROSITE profilePS5174516.051415508IPR000270PB1 domain
SuperFamilySSF542779.81E-10429492No hitNo description
PfamPF023096.4E-7461504IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MSQATPTQEL AARDLHGYEW RFKHIFRGQP RRHLLTTGWS TFVTSKRLVA GDSFVFLRGD  60
NGELRVGLRR VARQQCSIPS SVISSQSMHL GVLATASHAV LTHTLFVVYY KPRTNQYIIG  120
LNKYLEAVKN GFSVGMRFKM RFEGEDTPER RFTGTIVGVG DISPEWSGSI WRSLKIQWDE  180
PATIQRPERV SPWDIEPFAA PASPNLTQQV VKSKRPRSVD IPTSEITTNP AASAFWYHGP  240
TQSRELVQRG SITEVQSSES HVWSMRQKEI DSNLNNNGSC NSRARPEGIW PSSSHMNVSL  300
NFFPDSAADN KCAKTQSIIS GFASSISRQS NGLINEQVER GRKFENSVGC RLFGIDLTSN  360
SGIAAVPEKE PAYPIVDYNG TQGLVPASSE AEKAQTMDVS MSSKEQKQVV PDTLAKESQS  420
KQGSTTSTRT RTKVQMQGGY KDLINELEKM FETGGELSTR EKWAVVFTDN EGDMMLVGDD  480
PWPEFCKMVK KIFIYSSEEV KKMSTRCKLP ASSFEGEGTV VSMESEHKSD A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A3e-931198155355Auxin response factor 1
4ldw_A3e-931198155355Auxin response factor 1
4ldw_B3e-931198155355Auxin response factor 1
4ldx_A4e-931198155355Auxin response factor 1
4ldx_B4e-931198155355Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.68131e-103catkin
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G100100.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1646980.0KT164698.1 Populus tomentosa clone Potom.002G07206 auxin response factor 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006375372.10.0auxin response factor 18 isoform X2
RefseqXP_024440876.10.0auxin response factor 18 isoform X1
SwissprotQ9XED81e-156ARFI_ARATH; Auxin response factor 9
TrEMBLA0A2K1XT900.0A0A2K1XT90_POPTR; Auxin response factor
STRINGPOPTR_0014s09560.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.11e-156auxin response factor 9