PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G077200.1
Common NamePOPTR_0014s07320g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 411aa    MW: 45992.6 Da    PI: 6.5161
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G077200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like74.12e-23157210155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k +l+Wt+eLH+rF++a++ L G++ A Pk+il++m+v+gL  e+v SHLQkYRl
  Potri.014G077200.1 157 KRKLVWTNELHNRFLQAIRIL-GIDGAHPKKILQHMNVPGLKKENVSSHLQKYRL 210
                         679******************.********************************8 PP

2Response_reg40.71.2e-1428128106
                         EESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHH CS
        Response_reg  28 eaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpee 106
                         +a+ +++al++l+ek+  ++lil+  ++p+m+ +e+l+++ e + +lpi+v++a ++e+ +l +l  Ga  +l+Kp+ +++
  Potri.014G077200.1   2 TATRATDALRILREKEdeINLILIETRLPDMNQYEILETLGELS-SLPIVVFSADNNESAMLGCLYKGAALYLMKPIIKND 81 
                         788999******887778**********************9999.9******************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001569.21E-11177No hitNo description
PROSITE profilePS5011021.907190IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23002.0E-14197No hitNo description
SuperFamilySSF521723.27E-13290IPR011006CheY-like superfamily
PfamPF000725.1E-9283IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5129410.454154213IPR017930Myb domain
SuperFamilySSF466894.48E-18155214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-25156214IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-21157210IPR006447Myb domain, plants
PfamPF002492.9E-6160209IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
TTATRATDAL RILREKEDEI NLILIETRLP DMNQYEILET LGELSSLPIV VFSADNNESA  60
MLGCLYKGAA LYLMKPIIKN DVKNLWQLTY RTKIKTAVSG KGSNSFHGGS SEEKASSVTA  120
GNPSSTMGMT DQKGKRKELE ETNNDDEDNN NLTVPKKRKL VWTNELHNRF LQAIRILGID  180
GAHPKKILQH MNVPGLKKEN VSSHLQKYRL YLKREQDAML KTMIRDCHPS STFNLQGGFS  240
QYTNSQFFMT ASQSEYGNNF QNNLCSPMSV HSLGSVHSPT HVKSNYNGIL IPNYGQVASQ  300
SKQLYPSYPN SNHTEIRTTT DGNFSSFGQK GNHSVEERLN QGTTLSNIGT HGPAFLGNSQ  360
QQVQFPLPQP QPLPEKEDES DILDIATVEE LELLVMQKEF LEDPNNDLWL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-16159213357Transcription factor LUX
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G077200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1834261e-126AC183426.2 Populus trichocarpa clone Pop1-45L17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440944.10.0two-component response regulator ARR14 isoform X3
TrEMBLA0A2K1XS190.0A0A2K1XS19_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0014s07320.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF145541114
Representative plantOGRP1117845
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01760.14e-39response regulator 14