PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G075200.2
Common NamePOPTR_0014s07130g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 824aa    MW: 89393.4 Da    PI: 6.2165
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G075200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.48e-21116171156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  Potri.014G075200.2 116 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 171
                         688999***********************************************999 PP

2START200.76.3e-633265501205
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela++a++elvk+a+ +ep+W +s     e++n +e+l+++++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    +
  Potri.014G075200.2 326 ELALAAMDELVKMAQTDEPLWIRSFdggrEILNHEEYLRTITPCIGmkpsgFVSEASRETGMVIINSLALVETLMDSN-RWAEMFPcviaR 415
                         5899*************************************99988999*9***************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksngh 161
                          +t++vi +g      g lqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd  ++ +  s+ +v +++lpSg+++++++ng+
  Potri.014G075200.2 416 TSTTDVIANGmggtrnGSLQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSVDTIRETSGaSPTFVNCRRLPSGCVVQDMPNGY 506
                         ****************************************************************9999*********************** PP

                         EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
               START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                         skvtw+eh+++++++ h+l+r+l++sg+ +ga++w atlqrq e
  Potri.014G075200.2 507 SKVTWIEHAEYDESQTHQLYRPLISSGMGFGAQRWIATLQRQSE 550
                         *****************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-2099173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-21103173IPR009057Homeodomain-like
PROSITE profilePS5007117.216113173IPR001356Homeobox domain
SMARTSM003891.7E-17114177IPR001356Homeobox domain
CDDcd000862.04E-18115173No hitNo description
PfamPF000462.2E-18116171IPR001356Homeobox domain
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PROSITE profilePS5084843.961317554IPR002913START domain
SuperFamilySSF559614.0E-34319551No hitNo description
CDDcd088756.03E-122321550No hitNo description
SMARTSM002342.4E-46326551IPR002913START domain
PfamPF018521.4E-54326550IPR002913START domain
SuperFamilySSF559613.75E-23579749No hitNo description
SuperFamilySSF559613.75E-23776816No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 824 aa     Download sequence    Send to blast
MSFGGFLENT SPGGGGARIV ADIPYNNNNM PTGAIVQPRL VSPSITKSMF NSPGLSLALQ  60
QPNIDGQGDI TRMSENFETS VGRRSREEEH ESRSGSDNMD GASGDDQDAA DNPPRKKRYH  120
RHTPQQIQEL EALFKECPHP DEKQRLELSR RLCLETRQVK FWFQNRRTQM KTQLERHENS  180
LLRQENDKLR AENMSIRDAM RNPMCSNCGG PAIIGDISLE EQHLRIENAR LKDELDRVCA  240
LAGKFLGRPI SSLASSLGPP MPNSSLELGV GSNGFAGLST VATTLPLGPD FVGGISGALP  300
VLTQTRPATT GVTGIGRSLE RSMFLELALA AMDELVKMAQ TDEPLWIRSF DGGREILNHE  360
EYLRTITPCI GMKPSGFVSE ASRETGMVII NSLALVETLM DSNRWAEMFP CVIARTSTTD  420
VIANGMGGTR NGSLQLMHAE LQVLSPLVPV REVNFLRFCK QHAEGVWAVV DVSVDTIRET  480
SGASPTFVNC RRLPSGCVVQ DMPNGYSKVT WIEHAEYDES QTHQLYRPLI SSGMGFGAQR  540
WIATLQRQSE CLAILMSSNV PSRDHTAITA SGRRSMLKLA QRMTANFCAG VCASTVHKWN  600
KLNAGNVDED VRVMTRKSVD DPGEPPGIVL SAATSVWLPV SPQRLFDFLR DERLRSEWDI  660
LSNGGPMQEM AHIAKGQDHG NCVSLLRASA MNANQSSMLI LQETCIDAAG SLVVYAPVDI  720
PAMHVVMNGG DSAYVALLPS GFAIVPDGPG SRGPPTTNGG PTANNNSNGG GPERVSGSLL  780
TVAFQILVNS LPTAKLTVES VETVNNLISC TVQKIKAALQ CES*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G075200.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320755.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9IC550.0B9IC55_POPTR; Uncharacterized protein
STRINGPOPTR_0014s07130.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]