PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G071800.1
Common NamePOPTR_0014s06750g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 459aa    MW: 50351.6 Da    PI: 9.1246
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G071800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.62.9e-25109153145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRCs++v++g+k+CErH+hrgr+rsrk +e+
  Potri.014G071800.1 109 DPEPGRCRRTDGKKWRCSKDVVAGQKYCERHMHRGRQRSRKLVEA 153
                         79****************************************997 PP

2WRC61.71.1e-19338373338
                 WRC   3 epgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsr 38 
                         e grCrRtDGKkWRC+r+v++++k+CE H+hrg+++
  Potri.014G071800.1 338 ELGRCRRTDGKKWRCRRDVVANQKYCEMHMHRGSKQ 373
                         679******************************765 PP

3QLQ50.46.9e-183872337
                 QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        +T +Ql++Lk+Q+l++Ky++a++ vPp+L+++i++
  Potri.014G071800.1 38 LTETQLHELKQQALIFKYIVAGLRVPPDLVVPIWH 72
                        79*******************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-93672IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.7273772IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.2E-123971IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.356109153IPR014977WRC domain
PfamPF088791.6E-21110152IPR014977WRC domain
PROSITE profilePS5166720.069336382IPR014977WRC domain
PfamPF088792.0E-16339373IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MEKRVSEESA PSMKLSLGIG AGDHGDDDQD DRHVFPQLTE TQLHELKQQA LIFKYIVAGL  60
RVPPDLVVPI WHSVASSSLG SFSGADIYRQ FPSFVGLSPQ GFDYRQMMDP EPGRCRRTDG  120
KKWRCSKDVV AGQKYCERHM HRGRQRSRKL VEASQTAAAS EKPSPHNSSK NSDNPTTHSS  180
NLAKVSSQIK APPLNNTPTI LTTCTTSCNS DIEITGMSLA TTANSDCKNP FTTMTTSIVT  240
GYKNTATMIA SAVHADITAT GNDYKSSINL KRHYIDDRNS NCSNSVTYKG IIDRNCSNKK  300
IKNAGSNVSQ GLNFSPKSVL QVQGCGASHI YMNDVELELG RCRRTDGKKW RCRRDVVANQ  360
KYCEMHMHRG SKQHLEASKP AAIPATIPFV PGNVHSYPAT NLPSKADRRS LNTDLCISIP  420
TSPQLIMTND DTRTISNSSD TTISDTMVGT YQNKNLSS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G071800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440947.10.0growth-regulating factor 9 isoform X2
TrEMBLA0A2K1XRP90.0A0A2K1XRP9_POPTR; Uncharacterized protein
TrEMBLA0A385JIJ20.0A0A385JIJ2_POPTO; Growth-regulating factor 9
STRINGPOPTR_0014s06750.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF92282022
Representative plantOGRP1249722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45480.19e-44growth-regulating factor 9