PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G060200.1
Common NamePOPTR_0014s05910g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 696aa    MW: 76706 Da    PI: 5.6685
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G060200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS308.22e-943406944374
                GRAS   4 lLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                          + ++Ae +++++  laq +Larl+++ + p g+p qR a+yf+ AL+  l++      ++ + s ++  n + ++ a+k fse+sPil+f
  Potri.014G060200.1 340 PICQAAELIENRNPVLAQGILARLNHQlSLPIGKPYQRTAFYFKDALQLLLHS------SSNN-SIDTACNLIFKIGAYKSFSEISPILQF 423
                         5789*********************99788999*******************9......3333.33444689******************* PP

                GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                         +++t+Nq +lea+eg er+Hi+Dfdi++G+QW++L+q+La +++g+psl+iT+++sp+s+++ el  t+e+L+ fA+e+++pfe ++l  +
  Potri.014G060200.1 424 ANFTCNQVLLEAFEGFERIHIVDFDIGYGGQWASLMQELALKTGGAPSLKITAFASPSSHDELELGFTQENLRIFASEMNMPFELEILSLE 514
                         ***************************************************************************************9666 PP

                GRAS 185 rledleleeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                         +l + + + +  r++++E++aVnl +   ++ +++ +l+      L++vk+lsPkvvv  ++ +d+++ +F +++ +a++ ys l++sl+a
  Potri.014G060200.1 515 SLGSGS-WPMppRTSEKEVTAVNLPIG--SFSNDPSTLPL----ALRFVKQLSPKVVVSLDRGCDRSDLPFGHHINHAIQSYSGLLESLDA 598
                         666553.333358888*********95..55555666665....*********************************************66 PP

                GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                             + ++ +k+Er+l+++ i+++v  +++       +   Wr+ + ++GF+p+++s+++++qa++l+++++++g++ve ++ slvl+W++
  Potri.014G060200.1 599 V-NVNLDTLQKIERFLVQPGIEKIVLGRHRC----PDRTPPWRNLFLQSGFTPLTFSNFTESQAEYLVQRTPVRGFHVETRQSSLVLCWQR 684
                         5.3566999*****************99887....88899*************************************************** PP

                GRAS 365 rpLvsvSaWr 374
                         + L+s+SaWr
  Potri.014G060200.1 685 KDLISASAWR 694
                         *********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.289311674IPR005202Transcription factor GRAS
PfamPF035146.8E-92340694IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010492Biological Processmaintenance of shoot apical meristem identity
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MKAMPLPSED FQGKGVLDFS SSTTSSPNSL YQYHHKWQNN NSKESCGFFV GGAEPTSVLD  60
TISRRSPPTS SSTLSSSQGG GGGGGGASTD TTNDVAAAGG SIPCVDEECG QQLGMEDWES  120
VLPGSPSQEQ SILRLIMGDI EDPSVGLNKL LQGGSRSLDM EHASGFGVVD QVFGFDISNM  180
SSASANFVAN NNNIDPSSIH GLFQQQQQQA AFDQDEKPQI LNPGMISNQN QHQSVQNPAM  240
FLPFSYSQLQ EHHNNQHFSS PPPSKRLNSG LVGVNYVPKV FDSRPPELFL PRQHQQQQQN  300
HQFQMLQQQQ QQRQGVIMNQ KIASDELANQ QQLQQAIINP ICQAAELIEN RNPVLAQGIL  360
ARLNHQLSLP IGKPYQRTAF YFKDALQLLL HSSSNNSIDT ACNLIFKIGA YKSFSEISPI  420
LQFANFTCNQ VLLEAFEGFE RIHIVDFDIG YGGQWASLMQ ELALKTGGAP SLKITAFASP  480
SSHDELELGF TQENLRIFAS EMNMPFELEI LSLESLGSGS WPMPPRTSEK EVTAVNLPIG  540
SFSNDPSTLP LALRFVKQLS PKVVVSLDRG CDRSDLPFGH HINHAIQSYS GLLESLDAVN  600
VNLDTLQKIE RFLVQPGIEK IVLGRHRCPD RTPPWRNLFL QSGFTPLTFS NFTESQAEYL  660
VQRTPVRGFH VETRQSSLVL CWQRKDLISA SAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3035269418375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.117830.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2118040.0AC211804.1 Populus trichocarpa clone POP017-B20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011033505.10.0PREDICTED: scarecrow-like protein 22 isoform X2
TrEMBLU5FPJ80.0U5FPJ8_POPTR; Uncharacterized protein
STRINGPOPTR_0014s05910.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP17501242
FabidsOGEF31833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-141GRAS family protein