PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G057800.1
Common NamePOPTR_0014s05690g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 409aa    MW: 45197.9 Da    PI: 7.2906
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G057800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.13.8e-41174251178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +CqvegC++ l +ak+yhrrhkvCe+hskap+v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  Potri.014G057800.1 174 RCQVEGCHVALLNAKDYHRRHKVCEMHSKAPKVIVLGLEQRFCQQCSRFHVVSEFDDAKRSCRRRLAGHNERRRKSSQ 251
                         6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.0E-35168236IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.376172249IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-38173253IPR004333Transcription factor, SBP-box
PfamPF031108.6E-32175248IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MENGGNKGQE NDHANLPWEI WELNTSRFDL VNSSNNTAAA AADTFFTTTA TSVVESGSSC  60
THPEGTSAHG FLFPYQNSWL YHHSNNNSYQ QLSLYAGDGS NLPPDPHLMC LKLGKRHYFE  120
NSTSNNNHSN HPVSDRHEVG GFSIGKRGKP YYSVGGGGGA HDGPSSSTSV NVPRCQVEGC  180
HVALLNAKDY HRRHKVCEMH SKAPKVIVLG LEQRFCQQCS RFHVVSEFDD AKRSCRRRLA  240
GHNERRRKSS QDPVSRNSSQ EKLMAGRFPY IASPTGCALS LLSSKADSWV SPSDLSSRSS  300
AALRELIAEH RTAILSRQLV LEKHLHHHAM EDLGESQPSS NFLITHQQQV LSEPHNWGRL  360
NDTSTHVTLD LMQAPSSAFG FLSPRGKNKE EEEECSELWS TMEGAHVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-31166248284squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.93960.0bud| catkin
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G057800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006375256.10.0squamosa promoter-binding-like protein 7 isoform X1
TrEMBLU5FPG50.0U5FPG5_POPTR; Uncharacterized protein
STRINGPOPTR_0014s05690.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.41e-37squamosa promoter binding protein-like 10