PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G037200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 343aa    MW: 37515 Da    PI: 7.3057
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G037200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.62.1e-31134187255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Potri.014G037200.1 134 PRMRWTTTLHAHFVHAVRLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 187
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15131188IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27132188IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-23134187IPR006447Myb domain, plants
PfamPF002493.0E-7135186IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MFSSSKHIIM RSVSPFPDLS LQISPPSVEA KETGYDGGLT RKALCSDRSS TTDSGSSGSD  60
LSHENGFLNQ ERSYNLGPSE PTLSLGFDMA DLSSQTLQLP RNLNHHHHQP QIYGRNFKRS  120
ARMINGVKRS VRAPRMRWTT TLHAHFVHAV RLLGGHERAT PKSVLELMNV KDLTLAHVKS  180
HLQMYRTVKS TDRGPGQELT DMGLSQRAGI LEVDALGLSS GKADANNLPQ PLNNPPPSPP  240
PPPLSSTQKN QRNSGPSSIL EGDEKNISSL EALTYVNVEA HDHSKEDGHA EALHMAANLK  300
ERLDSSSSSS SDMLLNLEFT LGRPSWQLDY AETTNELTLL KC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16135189357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16135189357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16135189357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16135189357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G037200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2719900.0KP271990.1 UNVERIFIED: Populus trichocarpa isolate Potri.014G037200_BESC-293 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440470.10.0probable transcription factor KAN4
TrEMBLA0A2K1XQ130.0A0A2K1XQ13_POPTR; Uncharacterized protein
STRINGPOPTR_0014s03650.11e-171(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.15e-67G2-like family protein