PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G025300.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 173aa    MW: 19517.2 Da    PI: 10.4686
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G025300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.85.8e-2178137357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         +R+++t+eq+ +Le l++   r+p+ +++e+++++l    +++ ++V++WFqN++a+e++
  Potri.014G025300.2  78 TRWNPTQEQIGILEMLYRGgMRTPNGQQIEDITAQLsrygKIEGKNVFYWFQNHKARERQ 137
                         7*****************99**************************************97 PP

2Wus_type_Homeobox117.84.8e-3878139465
   Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         tRW+Pt+eQi iLe+ly+ G+rtPn ++i++ita+L++yGkie+kNVfyWFQN+kaRerqkq
  Potri.014G025300.2  78 TRWNPTQEQIGILEMLYRGGMRTPNGQQIEDITAQLSRYGKIEGKNVFYWFQNHKARERQKQ 139
                         8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.86373138IPR001356Homeobox domain
SuperFamilySSF466895.99E-1274144IPR009057Homeodomain-like
SMARTSM003895.2E-675142IPR001356Homeobox domain
CDDcd000869.23E-578139No hitNo description
PfamPF000461.0E-1878137IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-779137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGSMKVHQLA RGFWEHEPSL TLGCKRLRPL APKLANTDHS VTSFDLKSFI RPDSGPRKLA  60
SSDEKKDSPQ GETHPGGTRW NPTQEQIGIL EMLYRGGMRT PNGQQIEDIT AQLSRYGKIE  120
GKNVFYWFQN HKARERQKQK RNSLGLSHSP RTPSPITIIS LDTRVCHCTQ QP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.163130.0stem
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G025300.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1457020.0EF145702.1 Populus trichocarpa clone WS0112_M11 unknown mRNA.
GenBankKF9827040.0KF982704.1 Populus tomentosa WOX4b (WOX4b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006374903.11e-119WUSCHEL-related homeobox 4
SwissprotQ6X7J95e-62WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLW8Q0311e-117W8Q031_POPTO; Homeobox-leucine zipper transcription factor family protein-like 3
STRINGPOPTR_0014s02540.11e-118(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.12e-64WUSCHEL related homeobox 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  3. Guo X, et al.
    Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation.
    PLoS Pathog., 2017. 13(2): p. e1006142
    [PMID:28158306]
  4. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]
  5. Kucukoglu M,Nilsson J,Zheng B,Chaabouni S,Nilsson O
    WUSCHEL-RELATED HOMEOBOX4 (WOX4)-like genes regulate cambial cell division activity and secondary growth in Populus trees.
    New Phytol., 2017. 215(2): p. 642-657
    [PMID:28609015]
  6. Yamaguchi YL, et al.
    Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots.
    Front Plant Sci, 2017. 8: p. 1195
    [PMID:28747918]