PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G025300.1
Common NamePOPTR_0014s02540g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 214aa    MW: 24467.5 Da    PI: 9.2089
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G025300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.28.9e-2178137357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         +R+++t+eq+ +Le l++   r+p+ +++e+++++l    +++ ++V++WFqN++a+e++
  Potri.014G025300.1  78 TRWNPTQEQIGILEMLYRGgMRTPNGQQIEDITAQLsrygKIEGKNVFYWFQNHKARERQ 137
                         7*****************99**************************************97 PP

2Wus_type_Homeobox117.27.4e-3878139465
   Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         tRW+Pt+eQi iLe+ly+ G+rtPn ++i++ita+L++yGkie+kNVfyWFQN+kaRerqkq
  Potri.014G025300.1  78 TRWNPTQEQIGILEMLYRGGMRTPNGQQIEDITAQLSRYGKIEGKNVFYWFQNHKARERQKQ 139
                         8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.86373138IPR001356Homeobox domain
SMARTSM003895.2E-675142IPR001356Homeobox domain
SuperFamilySSF466891.07E-1175144IPR009057Homeodomain-like
PfamPF000461.6E-1878137IPR001356Homeobox domain
CDDcd000862.49E-478139No hitNo description
Gene3DG3DSA:1.10.10.604.1E-779137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MGSMKVHQLA RGFWEHEPSL TLGCKRLRPL APKLANTDHS VTSFDLKSFI RPDSGPRKLA  60
SSDEKKDSPQ GETHPGGTRW NPTQEQIGIL EMLYRGGMRT PNGQQIEDIT AQLSRYGKIE  120
GKNVFYWFQN HKARERQKQK RNSLGLSHSP RTPSPITIIS LDTRGEVEKD EDSPYKRKCR  180
SWSFECFELE ESRSCKEEGD RTLELFPLHP EGR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.163130.0stem
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G025300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1457020.0EF145702.1 Populus trichocarpa clone WS0112_M11 unknown mRNA.
GenBankKC6912500.0KC691250.1 Populus x canadensis WUSCHEL-related homeobox 4 (WOX4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006374903.11e-158WUSCHEL-related homeobox 4
SwissprotQ6X7J96e-74WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLB9MVU11e-157B9MVU1_POPTR; WOX family protein
TrEMBLR9RIF31e-157R9RIF3_POPCA; WUSCHEL-related homeobox 4
STRINGPOPTR_0014s02540.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61323452
Representative plantOGRP71671117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.13e-76WUSCHEL related homeobox 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  3. Guo X, et al.
    Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation.
    PLoS Pathog., 2017. 13(2): p. e1006142
    [PMID:28158306]
  4. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]
  5. Kucukoglu M,Nilsson J,Zheng B,Chaabouni S,Nilsson O
    WUSCHEL-RELATED HOMEOBOX4 (WOX4)-like genes regulate cambial cell division activity and secondary growth in Populus trees.
    New Phytol., 2017. 215(2): p. 642-657
    [PMID:28609015]
  6. Yamaguchi YL, et al.
    Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots.
    Front Plant Sci, 2017. 8: p. 1195
    [PMID:28747918]