PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G013400.1
Common NamePOPTR_0014s01390g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family bZIP
Protein Properties Length: 145aa    MW: 16597.9 Da    PI: 11.5913
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G013400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.31.2e-1155106556
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         ++ rr+ +NRe+ArrsR RKk+ +e L++    L+ +N++L+++l ++ +++
  Potri.014G013400.1  55 RKRRRMVSNRESARRSRWRKKKHLEDLTQQLNRLKIQNRELQNRLGSIINQS 106
                         5779999***********************************9998877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-951122IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-953102No hitNo description
PROSITE profilePS5021710.62253102IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.04E-1155107No hitNo description
PfamPF001702.1E-955107IPR004827Basic-leucine zipper domain
CDDcd147025.14E-1456107No hitNo description
PROSITE patternPS0003605873IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MFSAQEAVQF EHPVHGPGFT ANEIQELLSL LQPPSPTEIS GSRGSNQAVY SIDERKRRRM  60
VSNRESARRS RWRKKKHLED LTQQLNRLKI QNRELQNRLG SIINQSHVLW RENGRLMSES  120
VALKARLSDL RLVLAAMNAM QQAQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15458RKRRR
25675RRRMVSNRESARRSRWRKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G013400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010999906.12e-95PREDICTED: basic leucine zipper 43
TrEMBLA0A2K1XNS91e-100A0A2K1XNS9_POPTR; Uncharacterized protein
STRINGPOPTR_0014s01390.12e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59963052
Representative plantOGRP1173246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59530.14e-22basic leucine-zipper 4