PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G012800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 610aa    MW: 65989 Da    PI: 8.5626
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G012800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.11.8e-24219263145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Potri.014G012800.1 219 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEG 263
                         79****************************************985 PP

2QLQ61.42.5e-21150185237
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         +FT +Q+++L++Q+l+yKy+aan+P+P++Ll++i+k
  Potri.014G012800.1 150 PFTQSQWMELEHQALIYKYIAANVPIPSNLLLPIRK 185
                         8*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-12149185IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.8E-16150184IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.576150185IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.663219263IPR014977WRC domain
PfamPF088797.3E-21220262IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MDFGVQVGLD GLVGSDTSNS GFASLAGSDP EAKQKLYGSG FLKQERPGNI DGDWRSSKLS  60
KTESMLLEQS NTSLLKSSSN FLFADGQQQQ QQMLSFSYPR SAPSAERSSQ NGTLPYFHLT  120
SSAHNRNTGY SSGIYNAASM HGVLTETRWP FTQSQWMELE HQALIYKYIA ANVPIPSNLL  180
LPIRKALDSA GFPSFSAGFF RPNTLPWGAF HMGFSSNTDP EPGRCRRTDG KKWRCSRDAV  240
ADQKYCERHM NRGRHRSRKP VEGQSGHSAA AATTVKPANG TSSSTSSSVV GLRSTVSDSL  300
TIAHNQQQAA SPSNLSASNT LSRMFLTKEN VGERTQDATA LSMLRSNMDL KSKETPFFIS  360
KQQNSYGESL RNEFGLVTSD SLLNHSQKSS SLMSCRNFGS SQDLTDQESV SQHSLRQFMD  420
DWPKSQSDRS AVSWPELDQQ SERTQLSISI PMAPADFMSS TSSPNNEKVT LSPLRLSREF  480
DPIQMGLGVG GGGGGIANEP NQRQANWIPI SWGTSMGGPL GEVLHNTNNN AAAECKTTSS  540
LNLMTYRWDN SPRIGSSPTG VLQKSAFASL SNSSAGSSPR AENKTNEGGS LCNDLLGSTI  600
VHSSSLPAM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G012800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4733683e-66AM473368.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X262323.6, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320016.30.0growth-regulating factor 1
TrEMBLA0A2K1XNU70.0A0A2K1XNU7_POPTR; Uncharacterized protein
STRINGPOPTR_0014s01320.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Representative plantOGRP33571226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.14e-97growth-regulating factor 1