PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G007200.1
Common NamePOPTR_0014s00780g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 608aa    MW: 66131.4 Da    PI: 6.7887
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G007200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.6e-24233277145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Potri.014G007200.1 233 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVEG 277
                         79****************************************985 PP

2QLQ57.83.4e-20162198137
                 QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         ++FT++Q+++L++Q+l+yKy+ a++PvP++L+ +++k
  Potri.014G007200.1 162 GPFTPSQWMELEHQALIYKYITARVPVPSNLIIPLKK 198
                         59******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.3E-12162198IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.49163198IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.6E-14163196IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.287233277IPR014977WRC domain
PfamPF088797.8E-21234276IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MDFGVLGLEG LVGPETSSEA PSHVSPPETK PKILGSVLSK RERSASSAQD DYWRTSKMPK  60
NDDFSVTKTM SLHQPTSLLR SNYMLSDDSR QQEHMMSFSS PRPETTPFLS KDGELVERST  120
QNHTALSFRY HQNTASSYIR SAGYDTGGLN AGMHGPLTGV RGPFTPSQWM ELEHQALIYK  180
YITARVPVPS NLIIPLKKSV YPYSLPGSST GSFPHNSLGW SAFHLGYPGN NTDPEPGRCR  240
RTDGKKWRCS RDAVADQKYC ERHINRGRHR SRKPVEGQTG HAATGTASSK VVPMSNSMSK  300
LAITSGGASN SIAMTTQQQF KILQPAAANT SADVDVNRAQ DAQSISMMSS TINRKSDESS  360
FFVPKQDILM EQCSQTEFGF VSSDSLLNPS QKSSYINSKP YESFLNFNDE ESQDQHPLRQ  420
FIDEWPKDQS NCSVISWPEE LKSDWTQLSM SIPMASSDFS SSSSSPTQEK LALSPMSLSC  480
EFDPVQMGLR VSVDHNESSQ KQTNWIPISW GTSIGGPLGE VLTTSTSHAD SCKSSSALSL  540
LREGCDGSPQ LGSSPTGVLQ KSTFCSLSNS SSGSSPRAES KKNNDTASLY EDVGGSIIAS  600
SSPIPPL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G007200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2826941e-145GU282694.1 Populus balsamifera isolate HAY07 haplotype A unknown protein gene, partial sequence.
GenBankGU2826951e-145GU282695.1 Populus balsamifera isolate HAY07 haplotype B unknown protein gene, partial sequence.
GenBankGU2826961e-145GU282696.1 Populus balsamifera isolate MGR10 haplotype A unknown protein gene, partial sequence.
GenBankGU2826971e-145GU282697.1 Populus balsamifera isolate MGR10 haplotype B unknown protein gene, partial sequence.
GenBankGU2826981e-145GU282698.1 Populus balsamifera isolate NWL07 haplotype A unknown protein gene, partial sequence.
GenBankGU2826991e-145GU282699.1 Populus balsamifera isolate NWL07 haplotype B unknown protein gene, partial sequence.
GenBankGU2827001e-145GU282700.1 Populus balsamifera isolate STL13 haplotype A unknown protein gene, partial sequence.
GenBankGU2827011e-145GU282701.1 Populus balsamifera isolate STL13 haplotype B unknown protein gene, partial sequence.
GenBankGU2827021e-145GU282702.1 Populus balsamifera isolate INU03 haplotype A unknown protein gene, partial sequence.
GenBankGU2827031e-145GU282703.1 Populus balsamifera isolate INU03 haplotype B unknown protein gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320668.10.0growth-regulating factor 1
TrEMBLB9IBM40.0B9IBM4_POPTR; Uncharacterized protein
STRINGPOPTR_0014s00780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Representative plantOGRP33571226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-119growth-regulating factor 1