PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G000700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 424aa    MW: 46972.3 Da    PI: 5.0768
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G000700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.21.6e-32202256155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr+rWt+eLHerF++av++L G+ekAtPk +l+lm+v+gLt++hvkSHLQkYRl
  Potri.014G000700.1 202 KPRMRWTTELHERFLDAVNKLDGAEKATPKGVLKLMNVEGLTIYHVKSHLQKYRL 256
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.781199259IPR017930Myb domain
SuperFamilySSF466894.66E-18200256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-31201257IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-25202257IPR006447Myb domain, plants
PfamPF002495.7E-9204255IPR001005SANT/Myb domain
PfamPF143796.9E-23292339IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MQVSTVQHQK YHPKSGPDSP VSLAYHVQLS KSTFQRSSVF CTSLYLSSSS ISETNRQLGN  60
FPFLPHPPTY SQSVSATDST KSPQLVSEDL SSPFDEERSD GFMIDFLNLS GDASEGGFHG  120
MNCTSDNLEL TEQLELQFLS DELDIAITDH GENPRLDEIY GTPETSSKPV TGFACYQNFP  180
SIAPPVDALS SQPSLGSSTA HKPRMRWTTE LHERFLDAVN KLDGAEKATP KGVLKLMNVE  240
GLTIYHVKSH LQKYRLAKYF PEKKEEKKAS CSEEKKAVSI IIDDDGKKKG TIQITEALRM  300
QMEVQKQLHE QLEVQRTLQL RIEEHARYLQ KIIEEQQKAG SALLSPKSLS SVTDPPKDSE  360
LPPPSPSAGA ESKTDSSSAL PSSKHKATDS ENFEKQASEK RIRLEEKLES ESEEAEVEDP  420
PAQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-24202259259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-24202259259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-24202259259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-24202259259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-24202259259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-24202259259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-24202259259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-24202259259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.014G000700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440038.10.0myb family transcription factor PHL6 isoform X2
SwissprotQ949U21e-131PHL6_ARATH; Myb family transcription factor PHL6
TrEMBLA0A2K1XN740.0A0A2K1XN74_POPTR; Uncharacterized protein
STRINGPOPTR_0007s15110.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF134691925
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-102G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]