PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.013G114900.1
Common NamePOPTR_0013s11930g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 464aa    MW: 52448.7 Da    PI: 6.521
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.013G114900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS310.73.2e-95834601373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lLl  A+a ++++   a + L++l + +s +gd++qR++ayf+ +Laarl+ + s  y+ +  ++ts    +ee+ a++ ++ vsP++
  Potri.013G114900.1  83 LIHLLLITATAADENNVGSALENLTELYQSVSFTGDSVQRVVAYFADGLAARLLTKKSPFYDMIMKEPTS----EEEFLAFTDLYRVSPYY 169
                         689**********************************************************998888875....788889999******** PP

                GRAS  92 kfshltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gv 174
                         +++h+taNqaIlea e+e     +++H+iDfd+s+G+QWp+L+q+L++++  ++  slRiTg+g+    s+eel+et++rL +fA+ + ++
  Potri.013G114900.1 170 QLAHFTANQAILEAYEKEednnnSALHVIDFDVSYGFQWPSLIQSLSEKAssGNRISLRITGFGK----SAEELQETESRLVSFAKGFrNL 256
                         ****************9988877889**********************99745556*********....9****************9758* PP

                GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                          fef+ l    l   +l +Lr k++E++aVnlv++l +l  +s+++++    +Lk ++sl+P +vv++eqe +++  sFl rf+e+l+y++
  Potri.013G114900.1 257 VFEFQGL----LRGSKLINLRKKKNETVAVNLVFHLNTLN-DSLKISD----TLKSIRSLNPSIVVLAEQEGSRSPRSFLSRFMESLHYFA 338
                         ******8....666677899****************9995.8888888....*************************************** PP

                GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllr........kvksd 347
                         a+fdsl+  lp es+er ++E+  lg+ei++++   +++    r  ++e+W+ r+e  GF  ++ls+k   qaklll+        +  +d
  Potri.013G114900.1 339 AMFDSLDDFLPLESSERLSIEKNHLGKEIKSMLNYDKDDaNCPRYDKMETWKGRMEGHGFAGMKLSSKSLIQAKLLLKirthycplQ--FD 427
                         **********************************999885789*********************************98333322221..22 PP

                GRAS 348 g.....yrveee.sgslv.lgWkdrpLvsvSaW 373
                         g     ++v e+ +g ++ lgW+dr L+++SaW
  Potri.013G114900.1 428 GesgggFKVFERdDGKAIsLGWQDRCLITASAW 460
                         2333447776543777778************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.11857428IPR005202Transcription factor GRAS
PfamPF035141.1E-9283460IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MEDIEEEELL NLSLATVTDS SGGDMKRKRK RSRADHVFNP LMNSYEGCSE AKIYRLLQMR  60
EQMIKLDHKK KAAVEETGKG LHLIHLLLIT ATAADENNVG SALENLTELY QSVSFTGDSV  120
QRVVAYFADG LAARLLTKKS PFYDMIMKEP TSEEEFLAFT DLYRVSPYYQ LAHFTANQAI  180
LEAYEKEEDN NNSALHVIDF DVSYGFQWPS LIQSLSEKAS SGNRISLRIT GFGKSAEELQ  240
ETESRLVSFA KGFRNLVFEF QGLLRGSKLI NLRKKKNETV AVNLVFHLNT LNDSLKISDT  300
LKSIRSLNPS IVVLAEQEGS RSPRSFLSRF MESLHYFAAM FDSLDDFLPL ESSERLSIEK  360
NHLGKEIKSM LNYDKDDANC PRYDKMETWK GRMEGHGFAG MKLSSKSLIQ AKLLLKIRTH  420
YCPLQFDGES GGGFKVFERD DGKAISLGWQ DRCLITASAW HCV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-42884618375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2134230.0AC213423.1 Populus trichocarpa clone POP042-P09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006376315.10.0hypothetical protein POPTR_0013s11930g
TrEMBLB9MW610.0B9MW61_POPTR; Uncharacterized protein
STRINGPOPTR_0013s11930.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP81961117
FabidsOGEF62002952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.11e-54SCARECROW-like 21