PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.013G077500.1
Common NamePOPTR_0013s07500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 341aa    MW: 37465.3 Da    PI: 7.9485
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.013G077500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.46.7e-2597141145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+
  Potri.013G077500.1  97 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVES 141
                         79****************************************986 PP

2QLQ65.11.8e-223571137
                 QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        s+FT +Q+q+L++Q+l+yKy++a++PvPp+L+++iq+
  Potri.013G077500.1 35 SPFTVSQWQELEHQALIYKYMVAGLPVPPDLVLPIQR 71
                        89*********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.2E-133571IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.5073671IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.1E-163670IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.76297141IPR014977WRC domain
PfamPF088794.0E-2198140IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MNSGGAGGVG VEGGGGGAAG MAAGGMGTAA MTMRSPFTVS QWQELEHQAL IYKYMVAGLP  60
VPPDLVLPIQ RSFESISHRF FHHPTMSYCT FYGKKVDPEP GRCRRTDGKK WRCSKDAYPD  120
SKYCERHMHR GRNRSRKPVE SQTMTQSSST VTSLTVTGSS SGTGSFQNLP LHTYSNPQGT  180
ASGTNQSYYH MNSIPYGIPT KDYRYLQELT PEGGEHSFLS EASGSNKGLQ IDSQLDNAWS  240
LMQSRVSSFP TEKSTENSML QSNHPQHSFF SSDFTTRESV KQDGQSLRPF FDEWPKNRDA  300
WSGLENDSSN QTSFSTTQLS ISIPMASSDF STSCRSPRDN *
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.013G077500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006375983.10.0growth-regulating factor 4
SwissprotQ6AWY61e-93GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLU5FRX00.0U5FRX0_POPTR; Uncharacterized protein
STRINGcassava4.1_011724m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47812951
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.16e-47growth-regulating factor 5